KEGG   Ruminococcus champanellensis: RUM_15860Help
Entry
RUM_15860         CDS       T02600                                 

Definition
Cellulase M and related proteins (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rch  Ruminococcus champanellensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rch00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RUM_15860
Enzymes [BR:rch01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     RUM_15860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1723319..1724338
Genome map
AA seq 339 aa AA seqDB search
MLKHLEALCRLCGTSGNEQDVRAYIQQTIGDLGTCTVDPLGNLLVLRKGRKRPEKTLMLS
AHMDEVGMIVTSIRSDGSLTFGAVGGVDPFVMIGRQVLVGDATLPGVIGAKAVHKLSAAQ
RDQAPTCDALSIDIGAVDAEQAKRYVRPGDFVHFLPNYRSMGDGMIASKALDDRAGCAIL
LDLLEQEPEYDTWFAFLVQEEVGLRGAMAAAYTIAPDYAIVLETTTASDIPDVSGAKQVC
RLGGGAVVSFMDRSTLYDRELYRLAFDTARREQIPVQTKTMIAGGNDSGAIHISGKGVRT
LAISAPCRYLHSPSCVLAYKDLCACEQLAGAMMQEIRQL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagcatttagaggctttgtgccgcctgtgtggcacttccggcaatgaacaggat
gtgcgtgcctatattcagcagaccattggcgatctcggcacatgcactgtggatcccctt
gggaatctgctggtgctgcgcaagggaagaaagcgcccggagaaaacgctgatgctttcc
gcccatatggacgaggttggtatgatcgtcactagtatccgttctgacggcagcctgact
ttcggggcagtaggaggcgtggatccctttgttatgatcggcagacaggtgctggtgggg
gatgcaacgctgcccggggtcatcggtgccaaggcggtgcataagctgtccgccgcccag
cgggatcaggcacccacctgtgatgccttgtccattgacattggtgcggtggatgcagag
caggcaaagcgttatgtgcgtcccggggatttcgtgcattttttgcccaactaccggagc
atgggggatggcatgatcgcctccaaggcgctggatgaccgggcaggctgtgccattttg
ctggatcttctggaacaggagccggagtatgacacctggtttgcattcctggtgcaggag
gaggtaggtctccggggagcgatggcggcggcgtataccattgctccggattacgccatt
gtactggaaaccaccactgccagtgacattccggacgtgtccggtgcaaagcaggtatgc
cggctgggcggcggtgctgtggtatcctttatggatcgcagcaccctgtatgaccgggag
ctgtaccggcttgcattcgataccgcccggcgggaacagattccggtgcagaccaagacc
atgatcgcagggggcaatgacagcggcgccattcatatttccggtaagggcgtccggacg
cttgccatttccgcaccctgccgatacctgcattcgccctcctgcgtgttggcgtacaag
gatctttgcgcctgtgagcaactggcaggggcaatgatgcaagagatccggcagctatga

DBGET integrated database retrieval system