KEGG   Ruminococcus champanellensis: RUM_15860Help
Entry
RUM_15860         CDS       T02600                                 

Definition
(GenBank) Cellulase M and related proteins (EC:3.2.1.4)
Organism
rch  Ruminococcus champanellensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1723319..1724338
Genome map
AA seq 339 aa AA seqDB search
MLKHLEALCRLCGTSGNEQDVRAYIQQTIGDLGTCTVDPLGNLLVLRKGRKRPEKTLMLS
AHMDEVGMIVTSIRSDGSLTFGAVGGVDPFVMIGRQVLVGDATLPGVIGAKAVHKLSAAQ
RDQAPTCDALSIDIGAVDAEQAKRYVRPGDFVHFLPNYRSMGDGMIASKALDDRAGCAIL
LDLLEQEPEYDTWFAFLVQEEVGLRGAMAAAYTIAPDYAIVLETTTASDIPDVSGAKQVC
RLGGGAVVSFMDRSTLYDRELYRLAFDTARREQIPVQTKTMIAGGNDSGAIHISGKGVRT
LAISAPCRYLHSPSCVLAYKDLCACEQLAGAMMQEIRQL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagcatttagaggctttgtgccgcctgtgtggcacttccggcaatgaacaggat
gtgcgtgcctatattcagcagaccattggcgatctcggcacatgcactgtggatcccctt
gggaatctgctggtgctgcgcaagggaagaaagcgcccggagaaaacgctgatgctttcc
gcccatatggacgaggttggtatgatcgtcactagtatccgttctgacggcagcctgact
ttcggggcagtaggaggcgtggatccctttgttatgatcggcagacaggtgctggtgggg
gatgcaacgctgcccggggtcatcggtgccaaggcggtgcataagctgtccgccgcccag
cgggatcaggcacccacctgtgatgccttgtccattgacattggtgcggtggatgcagag
caggcaaagcgttatgtgcgtcccggggatttcgtgcattttttgcccaactaccggagc
atgggggatggcatgatcgcctccaaggcgctggatgaccgggcaggctgtgccattttg
ctggatcttctggaacaggagccggagtatgacacctggtttgcattcctggtgcaggag
gaggtaggtctccggggagcgatggcggcggcgtataccattgctccggattacgccatt
gtactggaaaccaccactgccagtgacattccggacgtgtccggtgcaaagcaggtatgc
cggctgggcggcggtgctgtggtatcctttatggatcgcagcaccctgtatgaccgggag
ctgtaccggcttgcattcgataccgcccggcgggaacagattccggtgcagaccaagacc
atgatcgcagggggcaatgacagcggcgccattcatatttccggtaagggcgtccggacg
cttgccatttccgcaccctgccgatacctgcattcgccctcctgcgtgttggcgtacaag
gatctttgcgcctgtgagcaactggcaggggcaatgatgcaagagatccggcagctatga

DBGET integrated database retrieval system