KEGG   Methanocella arvoryzae: LRC583Help
Entry
LRC583            CDS       T00526                                 

Gene name
thrC-3
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
rci  Methanocella arvoryzae
Pathway
rci00260  Glycine, serine and threonine metabolism
rci00750  Vitamin B6 metabolism
rci01100  Metabolic pathways
rci01110  Biosynthesis of secondary metabolites
rci01120  Microbial metabolism in diverse environments
rci01230  Biosynthesis of amino acids
Module
rci_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rci00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LRC583 (thrC-3)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LRC583 (thrC-3)
Enzymes [BR:rci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LRC583 (thrC-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CAJ35510
UniProt: Q0W7Y3
Position
2724547..2725788
Genome map
AA seq 413 aa AA seqDB search
MQIKYLQCARCGRTYPREEVRYRCECGDSIELIYDYSEIRGRISWDQLRSRPFDHWRYRE
FYPHLDVWSIISMGEGGTPLVRSRNIAREPGFGELFFKLESLNPTGSFKDRGSTVEISQA
YHYLCHHGECENEIVCASTGNMGASVAAYCARGGIRCTIYVPNDTAKIKLLQMMAHGAEI
VRVDGDYTVAMHTAKREYEERGRYLAGDYPYRGEGEKSVGLEVIDQLNGVPDYIVCPIGN
GTLVHGIWKGLKELKITGLLQRLPKIIGVQAGGCNTVARSFEEGRDDITPVVPHTLMDAV
ACGDPLDGTWALRAIRESEGWATAVSDVEGARARDLLGKKEGIFAELSGALSMAGLIKAY
QAEVIEKDARVVALVTGHGLKEPETFEDEIRTIGELVNVRDSILPLANRPESQ
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcaagtatctccagtgtgccaggtgtggccggacttatccccgggaggaggta
cgctacagatgcgagtgcggggacagcatagagctgatctatgattattcggaaatccgg
ggacgcatttcctgggatcagcttcggtcccggccgttcgaccactggcggtaccgggag
ttctacccgcatcttgacgtctggagcatcatctccatgggcgaagggggcactcctctg
gtccgctcgagaaacattgccagggagcctggtttcggggaactctttttcaagctggag
agcctgaatccgactggctcgttcaaagatcggggctctacagtggagatctcccaggcc
taccactacctctgccaccacggtgagtgcgagaacgagatcgtctgcgcctctactggc
aatatgggcgccagcgtcgcagcctattgtgcccggggtggcatcaggtgcacgatctac
gtgccaaatgatacggcgaagatcaagctgctccagatgatggcacacggggcggagatc
gtcagagtggacggcgactatactgtggccatgcacacggccaagcgggaatatgaagaa
agagggcggtatctggccggcgactacccctaccgtggcgaaggtgagaagtctgtaggc
ctggaagtgatcgatcagctgaacggcgtgccggactacatcgtctgccctatcggcaac
ggcaccctggttcacggcatctggaaaggcctgaaagagctgaagatcaccgggctgctt
cagaggttgccgaagatcatcggggtacaggccgggggctgtaacactgtggccagatcg
ttcgaggaggggcgggatgacatcacgccggtcgtgccgcacaccctcatggatgcggtg
gcgtgcggcgatccgctggacggcacctgggcgctgagagcgatcagggagtcggagggc
tgggccaccgccgtctcagacgtcgagggagccagagcccgggacctgctcgggaaaaaa
gagggtatcttcgcagagctgtctggcgccctgagtatggcaggcctgatcaaggcttat
caggcagaggtcatcgagaaagatgcccgggtggtagcccttgtcacaggccacggcctg
aaggagcccgagaccttcgaagatgagataaggacgatcggcgagctggtaaatgtccgg
gactctattctacctcttgcgaacagaccagaatcacagtag

DBGET integrated database retrieval system