KEGG   Methanocella arvoryzae: LRC583Help
Entry
LRC583            CDS       T00526                                 

Gene name
thrC-3
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rci  Methanocella arvoryzae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rci00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LRC583 (thrC-3)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LRC583 (thrC-3)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LRC583 (thrC-3)
Enzymes [BR:rci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LRC583 (thrC-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2724547..2725788
Genome map
AA seq 413 aa AA seqDB search
MQIKYLQCARCGRTYPREEVRYRCECGDSIELIYDYSEIRGRISWDQLRSRPFDHWRYRE
FYPHLDVWSIISMGEGGTPLVRSRNIAREPGFGELFFKLESLNPTGSFKDRGSTVEISQA
YHYLCHHGECENEIVCASTGNMGASVAAYCARGGIRCTIYVPNDTAKIKLLQMMAHGAEI
VRVDGDYTVAMHTAKREYEERGRYLAGDYPYRGEGEKSVGLEVIDQLNGVPDYIVCPIGN
GTLVHGIWKGLKELKITGLLQRLPKIIGVQAGGCNTVARSFEEGRDDITPVVPHTLMDAV
ACGDPLDGTWALRAIRESEGWATAVSDVEGARARDLLGKKEGIFAELSGALSMAGLIKAY
QAEVIEKDARVVALVTGHGLKEPETFEDEIRTIGELVNVRDSILPLANRPESQ
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcaagtatctccagtgtgccaggtgtggccggacttatccccgggaggaggta
cgctacagatgcgagtgcggggacagcatagagctgatctatgattattcggaaatccgg
ggacgcatttcctgggatcagcttcggtcccggccgttcgaccactggcggtaccgggag
ttctacccgcatcttgacgtctggagcatcatctccatgggcgaagggggcactcctctg
gtccgctcgagaaacattgccagggagcctggtttcggggaactctttttcaagctggag
agcctgaatccgactggctcgttcaaagatcggggctctacagtggagatctcccaggcc
taccactacctctgccaccacggtgagtgcgagaacgagatcgtctgcgcctctactggc
aatatgggcgccagcgtcgcagcctattgtgcccggggtggcatcaggtgcacgatctac
gtgccaaatgatacggcgaagatcaagctgctccagatgatggcacacggggcggagatc
gtcagagtggacggcgactatactgtggccatgcacacggccaagcgggaatatgaagaa
agagggcggtatctggccggcgactacccctaccgtggcgaaggtgagaagtctgtaggc
ctggaagtgatcgatcagctgaacggcgtgccggactacatcgtctgccctatcggcaac
ggcaccctggttcacggcatctggaaaggcctgaaagagctgaagatcaccgggctgctt
cagaggttgccgaagatcatcggggtacaggccgggggctgtaacactgtggccagatcg
ttcgaggaggggcgggatgacatcacgccggtcgtgccgcacaccctcatggatgcggtg
gcgtgcggcgatccgctggacggcacctgggcgctgagagcgatcagggagtcggagggc
tgggccaccgccgtctcagacgtcgagggagccagagcccgggacctgctcgggaaaaaa
gagggtatcttcgcagagctgtctggcgccctgagtatggcaggcctgatcaaggcttat
caggcagaggtcatcgagaaagatgcccgggtggtagcccttgtcacaggccacggcctg
aaggagcccgagaccttcgaagatgagataaggacgatcggcgagctggtaaatgtccgg
gactctattctacctcttgcgaacagaccagaatcacagtag

DBGET integrated database retrieval system