KEGG   Methanocella arvoryzae: LRC80Help
Entry
LRC80             CDS       T00526                                 

Definition
putative type III restriction-modification system, restriction subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
rci  Methanocella arvoryzae
Brite
Enzymes [BR:rci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     LRC80
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3155850..3158657
Genome map
AA seq 935 aa AA seqDB search
MRGDDSMGKFVIDKLIINSPYEEPKEYWSYNPGVKLFERIKGRRPAGYLIASERSRTYDD
PGEFRSIKLVNDIRPRIKQWREAGYPGATGVTRRLLEHWHNIEERDRRFFFCQLEAIETL
IWLTEAPDADKVGIIDQIQGDGGPFRRLCSKMATGSGKTIVMAMLIAWQVLNKVTYPQDS
RYSKNIFVVAPGLTVKSRLGVLIPSSEGNYYDEFNIVPIADREKLRQGKVMIRNWQALAW
ESAERLQKKKSVDKRGPKSDEAYVREVLEDMAGASNIVVINDEAHHAWRIVPGEKLAGLS
KEEKEEATVWISGLDRIHKARNILTCYDFSATPFVPSGKKSTEEALFGWIVSDFGLNDAI
ESGLVKTPRIVVRDDALPDAKSYMSKLYHVYEHVKEDLARKAEETEPLPDLVINAYDLLG
ADWLETKKSWEERGYPVPPVMISVVNITNTAARVEYAFTHKKVHVDELCDPKKLLHIDSK
VLDMAESEVSTTIEPVAADGSDSEDGEQKLSKKELAELLRRKVDTVGQVGKPGEQIQNVI
SVGMLSEGWDAKTVTHIMGLRAFTSQLLCEQVVGRGLRRTSYDINPETGLFDAEYVNIFG
VPFTFLPHEASEGTGPVPPQPKWRVEPLPQKSQYEIRWPNILRVDYTYKTVMSLDMDKVK
PLVIDAKDTVISAELAAVIEGKPNFESLTEIDLEKLGKMYRMQRIIFESARDIFEMMRGK
WKGDERFLMAQLVRIVQDFLKSDKLKISQTLYAQDDLRRRILIMLNMTKVVQHVANEIKL
SNSEAIVPVFDPERPSRTTGDMQAWYTSKPNHLTQKSHINLVVYDSAWEATEAYRLDHSS
DVEAWVKNDHLGFEIVYMFNGVVRKYRPDFIVRLKGGKHLVLEVKGQETFQDQVKRAALE
EWIKAVNQHGGFGVWSSAVSRDPADVEEIIRKECQ
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
gtgaggggtgacgatagcatgggaaagttcgtcatcgataagctcatcatcaactcgccg
tacgaggagccgaaggagtactggtcgtacaatccaggcgtcaagctgttcgagcggatt
aaaggccgtcggcctgccggatatctgatcgcttccgagcggtcaagaacctatgacgac
cctggtgaattccgttccatcaagcttgtcaacgatattaggccgcgcatcaagcagtgg
cgggaagccggctatccgggggcaactggtgttacccggcgattgctggagcactggcat
aatatcgaggagcgggaccgcagattcttcttctgccagcttgaggctatcgaaacgctg
atctggcttactgaagctcccgatgcggataaagtggggatcatcgaccagattcagggc
gacggtgggcctttcaggcgactatgctctaagatggccaccggcagcggcaagacgatc
gttatggccatgcttattgcatggcaggtcctgaataaggtaacatatccacaggacagc
cgttattcgaaaaacattttcgttgtagctcccgggttgacagtaaagagccggctcggt
gtacttattccttcatcggaaggcaactactacgatgagttcaatatcgttccgatcgct
gacagggaaaagctccgtcagggcaaagttatgatcaggaactggcaggcgctggcgtgg
gagtctgcggagcgtctccagaagaagaagagcgtagataagcgcgggcccaagagcgac
gaggcttatgtgcgtgaagtactggaggacatggccggagcaagcaacatcgtggttatc
aacgatgaggctcaccatgcctggcgtattgtccccggggagaagctggccgggctcagc
aaggaagaaaaggaagaggctaccgtctggatcagtggcctcgaccgtatccataaagct
cgcaacatcctgacctgctacgatttctcggctacaccatttgtgccttccggcaagaag
agcaccgaagaggcactgttcggctggatcgtcagcgacttcgggctcaacgatgctatc
gaatccgggctggtcaagacgccgagaattgtcgtcagagatgatgcgctgcccgatgct
aagagctacatgtcgaaactttatcacgtgtacgagcacgtgaaagaagaccttgccaga
aaagcagaggagaccgagccgcttcctgatctggtgatcaatgcctatgatctcctcgga
gctgactggcttgaaactaaaaagtcctgggaagagcgaggctatccggtaccaccggtg
atgatctcagtggtcaatattaccaatactgcggcgagagtggagtatgcctttacccat
aaaaaggtgcatgtcgacgagctatgcgatcctaaaaagctgctgcacatagatagtaaa
gttctcgatatggcagaatctgaggtatctactaccattgaaccagtggctgcagacggt
tcagattcagaagatggtgagcagaagctttcaaagaaagaactggctgagttgttgcgt
agaaaagtcgataccgtcggacaggttggtaagcctggagagcagatacagaacgttatc
tcagtcggcatgctatcggaaggctgggatgctaagactgtgacccatatcatgggtttg
agagcttttaccagccagctactgtgcgagcaggttgttgggcgtgggcttcgaagaact
tcctatgatattaatccagaaacaggcctgttcgacgctgagtacgtaaacatctttgga
gtgcccttcacattcctgcctcacgaggcatcggaaggcaccggcccggtaccgccacag
ccaaagtggagagtagagcccctgccgcagaagagccagtacgaaataagatggccgaac
atcctgcgggtcgactatacctataaaaccgttatgagccttgatatggataaagtgaag
ccgcttgtgatagatgcgaaagataccgtaatcagtgcagaactggccgcagtcatcgaa
ggcaagcccaatttcgagagcctgacggagatcgacctggaaaagctcggcaaaatgtac
cgcatgcagcgcattatattcgagtctgcacgggatatctttgagatgatgaggggcaaa
tggaagggcgatgagaggttcctgatggctcagctggtcaggattgtccaggacttcctc
aagtctgacaagctcaagatttcccagactctttatgcgcaggatgacctcaggagacgg
attttgatcatgctgaacatgaccaaggtcgtccagcacgtggccaatgagatcaagctg
tctaattccgaggcaatagtgcctgttttcgaccctgaacgtccgtcgaggacgacaggg
gatatgcaggcatggtataccagtaagcccaatcatttgacccagaagtcgcatatcaac
cttgttgtttacgacagcgcgtgggaggccactgaagcgtaccggctcgatcacagcagc
gatgttgaagcatgggtaaagaacgaccacctcggctttgagatcgtctatatgttcaac
ggtgtcgtgcgaaagtaccgtcctgacttcatcgtccggctcaaaggtggtaagcatctt
gtgctggaagtgaaagggcaggagactttccaggatcaggtcaagcgtgctgcgcttgaa
gagtggataaaggccgtcaaccagcatggcgggtttggggtgtggagttcggcggtgtcg
agagatccggctgatgttgaggagattattagaaaagaatgtcaataa

DBGET integrated database retrieval system