KEGG   Methanocella arvoryzae: RCIX1126Help
Entry
RCIX1126          CDS       T00526                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rci  Methanocella arvoryzae
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rci00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RCIX1126 (deoA)
Enzymes [BR:rci01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     RCIX1126 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1784865..1786376
Genome map
AA seq 503 aa AA seqDB search
MKLRAQPYDIEVGRYEVIINSADAEELGVLAGDRVQVKDKDTITAVVETTDAIVSPGKIG
IYREAWESIKVVPDEVVEVLPAAKPKSVSFIRKKMDKQKLTSEEMHAIIEDIVDGNLTEV
ELTAFVTASYIYTMDSDEIEWMTRAMVKTGDQISFDVHPVMDHHSIGGVPGNKISLCIVP
IIAAAGLLIPKTSSRAITGAGGSADLMEILCPVSFRADEIKKMTTKVGGCLVWGGATNIA
PADDKIINVEYPLSIDPKSQLLASVMAKKFAVGADTMVLDIPCGNETKIPTVQEGRKLAR
DFMELGDRLGMKIECALTYGGTPLGRAIGGGVEVREAMVMLEKFEGPRSLLEKTIAISGM
MLEMGGVAPKNEGAKMAVELVKSGKALQKFKEIIEVQGGDPKVTSDMVPIGDKVATVLSP
QDGYVLEISNKRLVYMCRLAGAPHDKGVGVILHKKKGEYVKKGDGLFTLYADKEWKLDAA
IKESLRNPIMMVEGMILEKIEVV
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcagagcacagccctatgacatcgaagtgggccggtacgaagtgatcatcaac
tccgccgacgcggaggagctaggcgtgctggcgggcgaccgcgtccaggtgaaggacaag
gatactattactgcggtcgtagagacgacggacgccatcgtgagcccgggcaaaatcggc
atctaccgcgaagcgtgggaatccattaaggtagtgcccgatgaggtggtcgaagtgctg
cccgcggccaagcccaagtcagtctccttcatcaggaagaagatggacaagcaaaagctg
accagcgaagagatgcacgccatcatcgaggacatcgtggacggcaacctcaccgaggtc
gagctgaccgccttcgtcacggcatcgtacatctacaccatggactcggacgagatcgag
tggatgacccgggctatggtgaagacgggcgaccagatctcgttcgacgtccacccggtc
atggaccaccacagcatcggcggcgtccccggcaacaagatctcgctctgcatcgtgccc
atcatcgccgcggcgggcctgctgatccccaagaccagcagccgggccatcaccggcgcc
ggaggcagcgcagacctcatggaaatcctctgccccgtcagcttcagggcggacgagatc
aagaagatgacgaccaaagtcggaggctgcctcgtctggggcggggccaccaacatcgcc
ccggcggacgacaagatcatcaacgtcgaatacccgctgtccatcgacccgaaatcccag
ttgctggcgtcggtcatggccaagaagtttgccgtaggcgcagacactatggtgctcgac
ataccgtgcggcaacgagaccaagattccgacagtgcaggaaggcaggaagctcgccagg
gacttcatggaactcggcgaccggttaggcatgaagatcgagtgcgccttaacgtatggc
ggcaccccgctgggccgggccatcggcggcggagtggaagtcagggaggccatggtcatg
cttgaaaagttcgaagggccccggagcttgttggagaagaccatcgccatctccggcatg
atgctggaaatgggcggcgtcgccccaaagaacgagggcgcgaagatggccgtcgaactg
gtcaagagcggcaaagccctgcaaaagttcaaggagatcatcgaagtccagggcggcgac
ccaaaggtcacctccgacatggtccccatcggcgacaaggtcgcgaccgtgctatccccc
caggacggctacgtcctcgaaatatccaacaagagactggtctacatgtgccgcctcgcc
ggcgccccccacgacaaaggagtgggcgtcattctccacaagaagaaaggggagtacgtg
aagaagggcgacggactctttacattgtatgcggacaaggagtggaagctggacgctgcg
ataaaagagtccctgaggaatccgatcatgatggtcgagggcatgatcctggagaaaatc
gaggtggtttaa

DBGET integrated database retrieval system