KEGG   Methanocella arvoryzae: RCIX1492Help
Entry
RCIX1492          CDS       T00526                                 

Definition
bifunctional hexulose-6-phosphate synthase/ribonuclease regulator
Orthology
K13831  
3-hexulose-6-phosphate synthase / 6-phospho-3-hexuloisomerase [EC:4.1.2.43 5.3.1.27]
Organism
rci  Methanocella arvoryzae
Pathway
Pentose phosphate pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Formaldehyde assimilation, ribulose monophosphate pathway
Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:rci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RCIX1492
   01230 Biosynthesis of amino acids
    RCIX1492
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RCIX1492
  Energy metabolism
   00680 Methane metabolism
    RCIX1492
Enzymes [BR:rci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.43  3-hexulose-6-phosphate synthase
     RCIX1492
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.27  6-phospho-3-hexuloisomerase
     RCIX1492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1475818..1477098
Genome map
AA seq 426 aa AA seqDB search
MRPILQVALDEIELRRAVEIAREAIAGGADYLEAGTPLIKSEGMNAVRTLKKEFRDHVIV
ADMKTMDTGAAEVEMAAKAGAGIVSILGASHDSTIEDALRSARKYGVKLAADLINVPDPV
GRAVRLQEIGVDILGVHVGIDQQMVGQDPIEVLKAVREAVSIPIAAAGGLDARSAAAAAS
LGAEIVIVGGNIIRSKDVTGAARTVRQALDSMGPVEIVKKSLDEEIRELFMQVSTPNISD
AMHRAPAMKDIKPMYEGIKIAGKAVTVQNFPGDWARPVEASDVAQPGEIIVINNFSKDVA
PWGELASHGAMQKGIAGVVIDGAIRDIDEIRRIRFPSFASAIVPNAGDPKGFGEINAEIV
CGGLTVRPGDWIIGDDNGVMVVPKERAYEVARRALEVKKNEDRVRVEIERGHTLAEVMDL
YKWEKK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagaccgatcttgcaggtggctctggatgaaattgagctgcggagggctgtcgagatc
gcccgggaggcgatcgccggcggcgccgactatctggaggcgggcactccgctgatcaag
agcgagggcatgaacgcggtgcgcacgctcaaaaaggagttccgggaccacgtgattgtg
gcggacatgaagaccatggatactggcgcagccgaagtggagatggcggcgaaggcaggg
gcggggatcgtctctatcctgggcgcctcccacgactcgaccatcgaggacgcgctccgg
tcggcccggaagtacggggtgaagctcgccgctgatctgatcaacgtgccggaccctgtc
ggacgggcggtgcgactgcaggagattggggtggatatactgggcgtccacgtgggcatc
gatcagcagatggtcggccaggacccgatagaggtgctgaaagcggtccgggaagctgta
agcattccgatcgctgctgcgggagggctggatgccaggtctgcggctgcagcggcttcc
ttaggtgcagaaattgtgatcgtcgggggcaacatcatccggtcgaaggacgtgaccggc
gctgcccggacggtccgtcaggctctcgatagtatggggcctgtcgagatcgtcaagaag
tcgctggacgaggagatccgggagctgttcatgcaggtgtctactcccaatatatcggac
gccatgcaccgggccccggccatgaaggacatcaagccgatgtacgagggcatcaagatt
gccggaaaggccgtgacggtgcagaacttcccgggtgactgggccaggccggtggaagcg
tctgacgtggcgcagccgggggagatcatcgtcatcaacaacttttccaaagacgttgct
ccgtggggggaattagcatcccacggcgccatgcagaagggcatcgcaggcgtcgtgatc
gatggagcaatcagggatatagacgagatccgccggatcaggttcccgtcgttcgcgtcg
gccatcgtgcccaatgccggcgaccccaagggcttcggggagatcaacgccgagatcgta
tgtggcggtttaacggtcaggcccggggactggatcatcggcgacgataacggcgtcatg
gtggtcccgaaagagagggcgtatgaggtggcccgtcgcgcgctggaggtcaagaagaac
gaggatcgggtgcgggtggagatcgagagagggcacacgctcgccgaggttatggacctg
tacaagtgggagaagaagtaa

DBGET integrated database retrieval system