KEGG   Methanocella arvoryzae: RCIX1492Help
Entry
RCIX1492          CDS       T00526                                 

Definition
(GenBank) conserved hypothetical protein (orotidine 5\'-phosphate decarboxylase domain/dimethylmenaquinone methyltransferase domain)
  KO
K13831  3-hexulose-6-phosphate synthase / 6-phospho-3-hexuloisomerase [EC:4.1.2.43 5.3.1.27]
Organism
rci  Methanocella arvoryzae
Pathway
rci00030  Pentose phosphate pathway
rci00680  Methane metabolism
rci01100  Metabolic pathways
rci01120  Microbial metabolism in diverse environments
rci01200  Carbon metabolism
rci01230  Biosynthesis of amino acids
Module
rci_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
rci_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:rci00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RCIX1492
  Energy metabolism
   00680 Methane metabolism
    RCIX1492
Enzymes [BR:rci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.43  3-hexulose-6-phosphate synthase
     RCIX1492
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.27  6-phospho-3-hexuloisomerase
     RCIX1492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RraA-like OMPdecase NMO NanE HMGL-like His_biosynth ThiG TMP-TENI DUF561 Trp_syntA FMN_dh
Motif
Other DBs
NCBI-ProteinID: CAJ36756
UniProt: Q0W4D7
Position
1475818..1477098
Genome map
AA seq 426 aa AA seqDB search
MRPILQVALDEIELRRAVEIAREAIAGGADYLEAGTPLIKSEGMNAVRTLKKEFRDHVIV
ADMKTMDTGAAEVEMAAKAGAGIVSILGASHDSTIEDALRSARKYGVKLAADLINVPDPV
GRAVRLQEIGVDILGVHVGIDQQMVGQDPIEVLKAVREAVSIPIAAAGGLDARSAAAAAS
LGAEIVIVGGNIIRSKDVTGAARTVRQALDSMGPVEIVKKSLDEEIRELFMQVSTPNISD
AMHRAPAMKDIKPMYEGIKIAGKAVTVQNFPGDWARPVEASDVAQPGEIIVINNFSKDVA
PWGELASHGAMQKGIAGVVIDGAIRDIDEIRRIRFPSFASAIVPNAGDPKGFGEINAEIV
CGGLTVRPGDWIIGDDNGVMVVPKERAYEVARRALEVKKNEDRVRVEIERGHTLAEVMDL
YKWEKK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagaccgatcttgcaggtggctctggatgaaattgagctgcggagggctgtcgagatc
gcccgggaggcgatcgccggcggcgccgactatctggaggcgggcactccgctgatcaag
agcgagggcatgaacgcggtgcgcacgctcaaaaaggagttccgggaccacgtgattgtg
gcggacatgaagaccatggatactggcgcagccgaagtggagatggcggcgaaggcaggg
gcggggatcgtctctatcctgggcgcctcccacgactcgaccatcgaggacgcgctccgg
tcggcccggaagtacggggtgaagctcgccgctgatctgatcaacgtgccggaccctgtc
ggacgggcggtgcgactgcaggagattggggtggatatactgggcgtccacgtgggcatc
gatcagcagatggtcggccaggacccgatagaggtgctgaaagcggtccgggaagctgta
agcattccgatcgctgctgcgggagggctggatgccaggtctgcggctgcagcggcttcc
ttaggtgcagaaattgtgatcgtcgggggcaacatcatccggtcgaaggacgtgaccggc
gctgcccggacggtccgtcaggctctcgatagtatggggcctgtcgagatcgtcaagaag
tcgctggacgaggagatccgggagctgttcatgcaggtgtctactcccaatatatcggac
gccatgcaccgggccccggccatgaaggacatcaagccgatgtacgagggcatcaagatt
gccggaaaggccgtgacggtgcagaacttcccgggtgactgggccaggccggtggaagcg
tctgacgtggcgcagccgggggagatcatcgtcatcaacaacttttccaaagacgttgct
ccgtggggggaattagcatcccacggcgccatgcagaagggcatcgcaggcgtcgtgatc
gatggagcaatcagggatatagacgagatccgccggatcaggttcccgtcgttcgcgtcg
gccatcgtgcccaatgccggcgaccccaagggcttcggggagatcaacgccgagatcgta
tgtggcggtttaacggtcaggcccggggactggatcatcggcgacgataacggcgtcatg
gtggtcccgaaagagagggcgtatgaggtggcccgtcgcgcgctggaggtcaagaagaac
gaggatcgggtgcgggtggagatcgagagagggcacacgctcgccgaggttatggacctg
tacaagtgggagaagaagtaa

DBGET integrated database retrieval system