KEGG   Methanocella arvoryzae: RCIX1692Help
Entry
RCIX1692          CDS       T00526                                 

Gene name
acs-1
Definition
(GenBank) acetyl-CoA synthetase (AMP-forming)
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rci  Methanocella arvoryzae
Pathway
rci00010  Glycolysis / Gluconeogenesis
rci00620  Pyruvate metabolism
rci00640  Propanoate metabolism
rci00680  Methane metabolism
rci00720  Carbon fixation pathways in prokaryotes
rci01100  Metabolic pathways
rci01110  Biosynthesis of secondary metabolites
rci01120  Microbial metabolism in diverse environments
rci01130  Biosynthesis of antibiotics
rci01200  Carbon metabolism
Module
rci_M00357  Methanogenesis, acetate => methane
rci_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:rci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCIX1692 (acs-1)
   00620 Pyruvate metabolism
    RCIX1692 (acs-1)
   00640 Propanoate metabolism
    RCIX1692 (acs-1)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    RCIX1692 (acs-1)
   00680 Methane metabolism
    RCIX1692 (acs-1)
Enzymes [BR:rci01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RCIX1692 (acs-1)
Lipid biosynthesis proteins [BR:rci01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RCIX1692 (acs-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CAJ36913
UniProt: Q0W3Y0
Position
1331050..1332795
Genome map
AA seq 581 aa AA seqDB search
MRKVGSVEVVEKFGVCNLDYHKTCNSGWCFDEAKKDFDWNYTGLVNIAHEAIDRHAASWR
KNKVALYWEGPNREHEKYTFSELKALSDKFGNVLRKAGIQKGDRVFVYLPRIPELYISAI
AIAKVGAIFAPLFGGFRAEAVRDRMNDCEARMVITTPDMKRLGIDPIRAEVPSLETVIVC
KADASYKYGEGELNFDAEMTYAPEEFKMEWCHLEDPVIMHYTSGTTGKSKGVVHVHNAMI
GHYITTKWVQDLRDDDVYWCTADPGWVTGTSYGIFGPWLCGASQVIYAGRFTADAWYSII
DRHKVTVWYTAPTALRMLMKAGDDVAAKYNLKSLRYITSVGEPLNPEVIRWGMKVYDLPI
HENYWMTETGCNMIANFYNLPLKIGSMGKPVPGIQAAVVDDKGNVLPPGVPGNLVIKPEW
PSMMRGIWNNEEKFKEYFRIPGWYVTGDSACVDSDGYFWFMGRVDDVIKTSGERVGPFEV
ESALLEHPACAEAGVIGKPDPLYGNIIKAFIALKPGFEGTEELKREISEFVKTKLAAHAY
PREIEFKSSLPKTRSGKIMRRVLKAQELGLPLGDLATLDDE
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcaaagtcggctctgtcgaagtagtcgaaaagttcggcgtgtgcaacctggactac
cacaagacctgcaacagcggctggtgcttcgacgaggcaaagaaggactttgactggaac
tacaccggcctggttaacatcgcccacgaggcgatcgaccggcatgccgcctcctggcga
aagaacaaggttgcgctctactgggagggcccgaacagggagcacgagaagtacaccttc
tccgagctgaaggccctgtccgacaagttcggcaacgtcctgcgcaaggccggcatccag
aagggagacagagtattcgtctacctgccccgcattccggaactttacatcagcgccatc
gccatcgccaaggtgggcgcaatcttcgctccgctcttcggcgggttcagggcagaggcg
gtcagggatcgcatgaacgactgcgaggccaggatggtcataactacgccggacatgaag
cgcctcggtatcgacccgatcagggccgaggtcccgtccctcgagactgtcatcgtctgc
aaggcggacgcgagctacaagtatggcgaaggcgagctgaacttcgacgcggagatgacc
tacgctcccgaagagttcaagatggagtggtgccacctcgaagacccggtcatcatgcac
tacacttccggcacgaccggcaaatcgaagggcgtcgtccacgtccacaacgccatgatc
ggccactacatcaccactaagtgggtgcaggacctgagggacgacgacgtctactggtgc
accgcagaccccggctgggtgacgggcacgtcctacggtatcttcgggccgtggctctgc
ggggcctcccaggtcatatacgcaggacggttcacggctgacgcctggtactccatcatc
gatcgccacaaggtcaccgtctggtacaccgcgcctacggcgctccgcatgctcatgaaa
gcgggcgacgacgtcgctgctaagtataacctgaagagcctgcggtacatcaccagcgtg
ggcgagcccctgaaccccgaagtgatcaggtggggcatgaaggtctacgacctcccgatc
cacgagaactactggatgacggagaccggctgcaacatgatcgccaacttctacaacctg
cccctgaaaatcggatccatgggcaagcctgtcccgggcatccaggctgcggtagttgac
gacaagggcaacgtgcttccccccggggtgccgggcaacctggtgatcaagcccgagtgg
ccttccatgatgcggggcatctggaacaacgaggagaagttcaaggagtacttccgcatc
cccggctggtacgtcaccggagacagcgcctgcgtcgacagcgacgggtacttctggttc
atgggccgggtcgacgacgtgatcaagacgtctggcgagagggtcgggcccttcgaagtg
gaaagtgcgcttctggagcacccggcatgcgcagaggccggcgtcatcggcaagccggac
ccgctctacggcaacatcatcaaagctttcatcgccctcaagcccggcttcgaaggcact
gaggagctgaagcgggagatttccgagttcgtcaagaccaagctcgcggcacacgcctat
cccagggagatcgagttcaagagcagcctgcccaagacccgcagcggcaagatcatgcgc
cgtgtcctgaaggcacaggagctcgggctgcccctgggcgacctcgctacgctggacgac
gagtga

DBGET integrated database retrieval system