KEGG   Methanocella arvoryzae: RCIX1692Help
Entry
RCIX1692          CDS       T00526                                 

Gene name
acs-1
Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rci  Methanocella arvoryzae
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:rci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RCIX1692 (acs-1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCIX1692 (acs-1)
   00620 Pyruvate metabolism
    RCIX1692 (acs-1)
   00640 Propanoate metabolism
    RCIX1692 (acs-1)
  Energy metabolism
   00680 Methane metabolism
    RCIX1692 (acs-1)
Enzymes [BR:rci01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RCIX1692 (acs-1)
Lipid biosynthesis proteins [BR:rci01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RCIX1692 (acs-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1331050..1332795
Genome map
AA seq 581 aa AA seqDB search
MRKVGSVEVVEKFGVCNLDYHKTCNSGWCFDEAKKDFDWNYTGLVNIAHEAIDRHAASWR
KNKVALYWEGPNREHEKYTFSELKALSDKFGNVLRKAGIQKGDRVFVYLPRIPELYISAI
AIAKVGAIFAPLFGGFRAEAVRDRMNDCEARMVITTPDMKRLGIDPIRAEVPSLETVIVC
KADASYKYGEGELNFDAEMTYAPEEFKMEWCHLEDPVIMHYTSGTTGKSKGVVHVHNAMI
GHYITTKWVQDLRDDDVYWCTADPGWVTGTSYGIFGPWLCGASQVIYAGRFTADAWYSII
DRHKVTVWYTAPTALRMLMKAGDDVAAKYNLKSLRYITSVGEPLNPEVIRWGMKVYDLPI
HENYWMTETGCNMIANFYNLPLKIGSMGKPVPGIQAAVVDDKGNVLPPGVPGNLVIKPEW
PSMMRGIWNNEEKFKEYFRIPGWYVTGDSACVDSDGYFWFMGRVDDVIKTSGERVGPFEV
ESALLEHPACAEAGVIGKPDPLYGNIIKAFIALKPGFEGTEELKREISEFVKTKLAAHAY
PREIEFKSSLPKTRSGKIMRRVLKAQELGLPLGDLATLDDE
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcaaagtcggctctgtcgaagtagtcgaaaagttcggcgtgtgcaacctggactac
cacaagacctgcaacagcggctggtgcttcgacgaggcaaagaaggactttgactggaac
tacaccggcctggttaacatcgcccacgaggcgatcgaccggcatgccgcctcctggcga
aagaacaaggttgcgctctactgggagggcccgaacagggagcacgagaagtacaccttc
tccgagctgaaggccctgtccgacaagttcggcaacgtcctgcgcaaggccggcatccag
aagggagacagagtattcgtctacctgccccgcattccggaactttacatcagcgccatc
gccatcgccaaggtgggcgcaatcttcgctccgctcttcggcgggttcagggcagaggcg
gtcagggatcgcatgaacgactgcgaggccaggatggtcataactacgccggacatgaag
cgcctcggtatcgacccgatcagggccgaggtcccgtccctcgagactgtcatcgtctgc
aaggcggacgcgagctacaagtatggcgaaggcgagctgaacttcgacgcggagatgacc
tacgctcccgaagagttcaagatggagtggtgccacctcgaagacccggtcatcatgcac
tacacttccggcacgaccggcaaatcgaagggcgtcgtccacgtccacaacgccatgatc
ggccactacatcaccactaagtgggtgcaggacctgagggacgacgacgtctactggtgc
accgcagaccccggctgggtgacgggcacgtcctacggtatcttcgggccgtggctctgc
ggggcctcccaggtcatatacgcaggacggttcacggctgacgcctggtactccatcatc
gatcgccacaaggtcaccgtctggtacaccgcgcctacggcgctccgcatgctcatgaaa
gcgggcgacgacgtcgctgctaagtataacctgaagagcctgcggtacatcaccagcgtg
ggcgagcccctgaaccccgaagtgatcaggtggggcatgaaggtctacgacctcccgatc
cacgagaactactggatgacggagaccggctgcaacatgatcgccaacttctacaacctg
cccctgaaaatcggatccatgggcaagcctgtcccgggcatccaggctgcggtagttgac
gacaagggcaacgtgcttccccccggggtgccgggcaacctggtgatcaagcccgagtgg
ccttccatgatgcggggcatctggaacaacgaggagaagttcaaggagtacttccgcatc
cccggctggtacgtcaccggagacagcgcctgcgtcgacagcgacgggtacttctggttc
atgggccgggtcgacgacgtgatcaagacgtctggcgagagggtcgggcccttcgaagtg
gaaagtgcgcttctggagcacccggcatgcgcagaggccggcgtcatcggcaagccggac
ccgctctacggcaacatcatcaaagctttcatcgccctcaagcccggcttcgaaggcact
gaggagctgaagcgggagatttccgagttcgtcaagaccaagctcgcggcacacgcctat
cccagggagatcgagttcaagagcagcctgcccaagacccgcagcggcaagatcatgcgc
cgtgtcctgaaggcacaggagctcgggctgcccctgggcgacctcgctacgctggacgac
gagtga

DBGET integrated database retrieval system