KEGG   Methanocella arvoryzae: RCIX1773Help
Entry
RCIX1773          CDS       T00526                                 

Gene name
acdB
Definition
acetyl-coa synthetase (ADP-forming), beta subunit (EC:6.2.1.13)
Orthology
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
rci  Methanocella arvoryzae
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCIX1773 (acdB)
   00620 Pyruvate metabolism
    RCIX1773 (acdB)
   00640 Propanoate metabolism
    RCIX1773 (acdB)
Enzymes [BR:rci01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     RCIX1773 (acdB)
Lipid biosynthesis proteins [BR:rci01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RCIX1773 (acdB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1262585..1263241
Genome map
AA seq 218 aa AA seqDB search
MTASTRLLNELEAKELLASYGITINAGQAVSSPTEAADAAAKLGFPVALKVLSDKISHKS
DLGLVALNIASADCARGAYDRIITAARALDPEATAVVQTMAAPGREVIVGAKRDPQFGPI
VLFGMGGVFVEVFKDVSIRVAPVDHQTAIEMIKEIKGYRMLTEFRGQKSVDIDALADVIV
NISRLIMEREDILELDANPVMAYESGAIAVDARVLLKD
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgtctacgaggctgcttaatgaacttgaggccaaggaactgctggccagctac
ggtatcacgataaacgcagggcaggccgtaagtagcccgacagaggcggctgatgcggcg
gcgaaactgggcttcccggtcgccctgaaggtgctgtcggacaagatctcccacaagagc
gacctcgggctcgtggcgctgaacatcgcctcggcagattgcgcccggggagcctacgat
cgcatcatcacagcagcgagggccctcgacccggaagccaccgcagtagtccagacaatg
gccgcccccggcagggaggtcatcgtcggagccaagagagacccccagttcgggccgatc
gtcctcttcggcatgggcggcgtgttcgtggaggtcttcaaggacgtctccatccgggta
gcgccggtagaccaccagacagctatagagatgatcaaggagatcaaaggctacaggatg
ctcaccgagttccggggccagaaaagcgtagatatagatgcgctggcggacgtgatcgta
aatatttcccggctcatcatggagcgggaggacatcttggagctggatgccaatcctgtc
atggcttacgagagtggagccatcgctgtggatgccagggttctgctaaaagattga

DBGET integrated database retrieval system