KEGG   Methanocella arvoryzae: RCIX1773Help
Entry
RCIX1773          CDS       T00526                                 

Gene name
acdB
Definition
(GenBank) acetyl-coa synthetase (ADP-forming), beta subunit
  KO
K22224  acetate---CoA ligase (ADP-forming) subunit beta [EC:6.2.1.13]
Organism
rci  Methanocella arvoryzae
Pathway
rci00010  Glycolysis / Gluconeogenesis
rci00620  Pyruvate metabolism
rci00640  Propanoate metabolism
rci01100  Metabolic pathways
rci01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCIX1773 (acdB)
   00620 Pyruvate metabolism
    RCIX1773 (acdB)
   00640 Propanoate metabolism
    RCIX1773 (acdB)
Enzymes [BR:rci01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     RCIX1773 (acdB)
Lipid biosynthesis proteins [BR:rci01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RCIX1773 (acdB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_5 ATP-grasp_2 IPT
Motif
Other DBs
NCBI-ProteinID: CAJ36977
UniProt: Q0W3R6
Position
1262585..1263241
Genome map
AA seq 218 aa AA seqDB search
MTASTRLLNELEAKELLASYGITINAGQAVSSPTEAADAAAKLGFPVALKVLSDKISHKS
DLGLVALNIASADCARGAYDRIITAARALDPEATAVVQTMAAPGREVIVGAKRDPQFGPI
VLFGMGGVFVEVFKDVSIRVAPVDHQTAIEMIKEIKGYRMLTEFRGQKSVDIDALADVIV
NISRLIMEREDILELDANPVMAYESGAIAVDARVLLKD
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgtctacgaggctgcttaatgaacttgaggccaaggaactgctggccagctac
ggtatcacgataaacgcagggcaggccgtaagtagcccgacagaggcggctgatgcggcg
gcgaaactgggcttcccggtcgccctgaaggtgctgtcggacaagatctcccacaagagc
gacctcgggctcgtggcgctgaacatcgcctcggcagattgcgcccggggagcctacgat
cgcatcatcacagcagcgagggccctcgacccggaagccaccgcagtagtccagacaatg
gccgcccccggcagggaggtcatcgtcggagccaagagagacccccagttcgggccgatc
gtcctcttcggcatgggcggcgtgttcgtggaggtcttcaaggacgtctccatccgggta
gcgccggtagaccaccagacagctatagagatgatcaaggagatcaaaggctacaggatg
ctcaccgagttccggggccagaaaagcgtagatatagatgcgctggcggacgtgatcgta
aatatttcccggctcatcatggagcgggaggacatcttggagctggatgccaatcctgtc
atggcttacgagagtggagccatcgctgtggatgccagggttctgctaaaagattga

DBGET integrated database retrieval system