KEGG   Methanocella arvoryzae: RCIX1774Help
Entry
RCIX1774          CDS       T00526                                 

Gene name
acdA
Definition
acetyl-coa synthetase (ADP-forming), alpha subunit (EC:6.2.1.13)
Orthology
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
rci  Methanocella arvoryzae
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rci00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rci00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:rci00640]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1261206..1262588
Genome map
AA seq 460 aa AA seqDB search
MSGHTLDPLLKPKSIAVIGASKDQSKWGYKVLYNILSNRYKGKVFPVNPSAQEILGKQCF
PDVTSIPDEVDLGVVIVPAQAAPSVIDDCGRKGVGALCVITSGFSEVGKEGAALEEDLKK
KAKAYGMRMLGPNTMGFVNRSISLNASIVPRMPYRGEISFISQSGALGLALTDWSIGSRL
GLNCIISTGNKADVSEADLLEYFDQDEDTWTISMYIEGLKDGRRFIEAASKVKKPMLAIK
AGVSQAGARAAASHTGSLAGSDAVYDSAFRQCGVIRVEGVEEMFDAAMAVSTQPRPEGNR
VAILSNGGGMAIMASDACERRGMQVPQLNKYTRAGIARLLPAFASVKNPVDTVAKSDYHI
YKEAMRALLDDKDIDCVMVIYAHAGMTDAMEPAQAVVDMLKEKYPKPVVACWMGGEDIDA
VARMFRKNRVPFYPVPERAAEALRTLIEYDSSLVRKKVKR
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgagcggccatactcttgatccactactcaagccgaagagcatcgcggtcatcggcgcc
tcaaaagaccagtccaagtggggctacaaggtactctacaacattctcagtaaccgctac
aaaggtaaagtgttcccggtaaacccttcggcacaggaaatactggggaagcagtgcttt
cccgacgtcacctcgatcccggacgaggtagacctgggagtagtaatcgtcccggcccag
gcagcgccttcagtgatcgacgactgcggcaggaaaggtgtcggagcgctgtgcgtgatc
acctccgggttcagcgaagtgggcaaggagggcgcggccctggaagaagacctgaaaaag
aaggcgaaggcttacgggatgcggatgctcggcccgaataccatgggcttcgtgaaccgg
agcatctcgctgaacgccagcatcgtgccccggatgccatacaggggcgagatttccttc
atcagccagagcggcgcgctgggcctggcgctgacggactggtccatcggctcccgcctg
ggcctgaactgcatcatcagcaccggcaacaaggcggacgtctcggaagcagatttgctg
gagtacttcgatcaggacgaggacacgtggaccatatccatgtatatcgaggggctgaaa
gacgggcgcaggttcatcgaggccgcctctaaggtgaaaaagcccatgctggccattaaa
gcgggagtcagccaggccggcgccagggcggcggcttcccacacgggcagcctcgcaggc
tccgacgcagtctacgactcggcgttccgccagtgcggcgtcatcagggtcgagggcgtg
gaggagatgttcgacgcggcgatggcggtatccacccagcccaggcctgaaggtaacagg
gtagccatcctctccaacggaggcggcatggcgatcatggcgagcgacgcgtgcgagcgc
aggggcatgcaggtgccgcagctcaacaagtacacaagggcaggcatcgcccggcttctg
cccgcattcgcatcggtgaaaaatcccgtggacacggtggcgaagtccgactaccacatc
tacaaagaggcgatgagggcgctcctcgacgataaggacatagactgcgtgatggtgata
tatgcgcatgcaggaatgaccgatgccatggagccggcccaggcagtggtagatatgctc
aaggaaaaatacccgaagcctgtcgtcgcctgctggatgggcggtgaagacatcgacgcg
gtggcgaggatgtttcgcaagaacagggtgccgttctaccctgtgcccgagcgagcagca
gaggcgctgcggactttgatagaatatgatagctcgctggtcaggaagaaggtgaagcga
tga

DBGET integrated database retrieval system