KEGG   Methanocella arvoryzae: RCIX1956Help
Entry
RCIX1956          CDS       T00526                                 

Gene name
asnB-1
Definition
asparagine synthetase, glutamine-hydrolyzing (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rci  Methanocella arvoryzae
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:rci00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1122385..1124247)
Genome map
AA seq 620 aa AA seqDB search
MCGINGFNWKDLRLISQMNDVTRHRGPDDHGIYQDEMVSLGHNRLSIIDLSEKGRQPMSS
EDGTVWITYNGEIYNYRELRRELLEKGHRFRSDTDTEVIIHAYEEFGHDFVRRLRGMWAF
CIYDQNRGTLLLSRDQFGIKPLYYHLSPGKIIFSSMISGILCHEIQTAPRARAIMEYLAF
NLEDHGTDTFFENIQSLATDSLLLYDLKSHEHRYLKWYDRKPRTTATAAAPDIKTLFTES
VRQRTIADVPIGSCLSGGVDSSAIVCILDQLLDGDFCTYSFVVPGSPIDESKYIREIGRT
TGARQLFTALDPDSFLAEIADFVAAQEEPVGGLSPYAQYRVMKLAHEHGAKVLLDGQGGD
ELFAGYVYYYSYYFYELFRSFRWLKLAREMLLYSRNSRKTYSSALFGFLLLPRAIQVRLW
KSRLNTWINHAYLKQVCGDTYDPRWSRMPLNDILNLSLFSTAIPEMMRWEDKNSMRWSIE
TRPPFLDVDLVEAMASVPAEEKLQDGKTKVIFRKAMDDILPPLIRDRKDKIGFAAPADEF
FRNEKIIAFCENIIYSDSFRSRPYWKWPEVEKIFRDHITGRRNAGDLIFKWINLELWLRH
FFEGRNISGAGPIPVFTSTP
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtattaacggattcaactggaaagacctgcgcttgatcagccagatgaacgat
gtaaccagacatagggggccggacgaccatggtatctaccaggacgaaatggtctcgctg
ggccataaccggctgtcgatcatcgatctctccgagaagggtcgccagccgatgtccagc
gaggatgggaccgtgtggatcacctataacggggaaatctacaattaccgggaactaagg
cgcgagttgctggagaagggccacaggttcaggagcgacaccgataccgaagtgatcatt
cacgcctatgaagagttcggccatgactttgtacgcaggctcaggggcatgtgggcattt
tgcatatatgaccagaaccggggcacgctactgttatcccgggaccagttcggcatcaag
cccctgtactatcacctcagccccgggaagatcatcttctcatcgatgatctccggcata
ctctgccatgagattcagacggctccccgcgccagggcaatcatggaatatcttgccttc
aacctggaagaccacggtacagatacgttcttcgaaaatatccagtccctggccaccgat
tctctcctcctctacgacctgaagagccacgagcacaggtatctgaagtggtacgatcga
aagccccggactacagctaccgctgctgcgccagacattaaaaccctctttacagaaagc
gtcaggcagcggacgatagctgacgtccccatcggcagctgcctgagcggcggagtcgac
tcgtcagcgatcgtctgcatcctcgatcagcttctggacggggatttttgcacgtactcc
ttcgtggtcccgggcagcccgatcgacgaaagcaagtatatccgggagatcggccggacc
actggtgcccggcagcttttcaccgcgcttgaccctgacagcttcctggcagagatcgca
gactttgtcgcggcacaggaggagcctgtaggggggctgagcccgtacgcacagtaccgg
gtgatgaaactggcgcacgagcacggggccaaagtcctgctggacgggcagggaggggat
gagctgttcgccggctacgtctactattacagctactatttctacgagctgtttcgctca
ttccggtggctaaagctggcacgggagatgcttctctactcccggaactcccggaaaacc
tacagcagcgccctattcgggttcctgctcctgccgagagcgatccaggtacggctgtgg
aaaagccgtctcaatacctggatcaaccacgcttacctgaagcaggtctgcggcgacacg
tacgatccccgctggagccggatgcccttgaacgacatcctgaacctctcgctcttcagc
acggcgatacctgaaatgatgcggtgggaggacaaaaactccatgcgctggagcatcgag
accaggccgccgttcctcgacgtcgatctggtggaggccatggcatccgtacctgcagag
gaaaagctacaggacggcaagaccaaggtcatcttccgcaaggccatggacgatatactg
cccccgcttatcagggaccgtaaagacaagatcgggttcgccgcaccggccgacgaattt
ttcaggaacgagaagatcatcgccttctgcgaaaacatcatctactccgacagcttccgg
agccggccgtactggaagtggcccgaggtggagaaaattttccgggaccacatcaccggc
cgcaggaacgccggcgacctcatcttcaagtggatcaaccttgagctgtggttgcgacac
ttcttcgaaggccggaatatttctggggccgggccaataccggttttcacttccaccccg
tga

DBGET integrated database retrieval system