KEGG   Methanocella arvoryzae: RCIX2071Help
Entry
RCIX2071          CDS       T00526                                 

Gene name
mtrH
Definition
tetrahydromethanopterin S-methyltransferase subunit H (EC:2.1.1.86)
Orthology
K00584  
tetrahydromethanopterin S-methyltransferase subunit H [EC:2.1.1.86]
Organism
rci  Methanocella arvoryzae
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogenesis, CO2 => methane
Methanogen
Class
Metabolism; Overview; Carbon metabolism [PATH:rci01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:rci00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1027499..1028437)
Genome map
AA seq 312 aa AA seqDB search
MFKYANQQKVYEVGRAKVGGQPGEYPTVLAGSIFYGKHKIVTDTKTGAFDKEVAEKLVRQ
QEEMSDITGNPIWLQIVADYGEAMGKYITWYADIGKDAFLIDSTVADARVAGAKKADEIG
LSDRVIYNSINAAAQAAEIEALQPLKFTSAIVLGFNAMDMSVKGRMEMFTKGGAGQPKGM
LTLATEKGITRPLLDVAATPLGSGSGATYRSIFAVKSQLGEPVGGGYHNIPSAWAWLKKF
KKQPGKEGAYMPSDIGSNLVAITLGCDFCLYGPIEHSVEVFPAVAMNDIIVAEAAKDLGT
VTVDEHPLKKLV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagtatgcaaatcaacagaaagtctacgaggttggtagagctaaggtaggcggc
cagccgggcgagtaccccaccgtactggcaggttctatcttctacggcaagcacaagatc
gtcaccgacaccaagaccggtgcgttcgacaaggaagttgcagagaagcttgtcaggcag
caggaagagatgagcgacatcaccgggaacccgatctggctccagattgtcgcagactat
ggcgaggccatgggcaagtacatcacctggtacgcagacatcggcaaggacgcattcctc
atcgactccaccgtcgcagacgcgagggtcgccggcgccaagaaggctgacgaaatcggc
ctgagcgacagggtcatctacaactcgatcaacgccgccgcacaggcagccgaaatcgag
gcactgcagcccctgaagttcacctccgccatcgtcctcggcttcaacgccatggacatg
tcggtcaagggcaggatggaaatgttcaccaagggcggcgcaggccagccgaagggcatg
ctcaccctcgccaccgagaagggcatcaccaggcccctcctcgacgtagcagcaaccccg
ctcggcagcggctccggtgcgacctacaggtccatcttcgctgtcaagtcccagctcgga
gagcctgtgggcggcggctaccacaacatcccgtccgcatgggcgtggctgaagaagttc
aagaagcagcccggcaaggaaggcgcatacatgccctccgacattggcagcaacctcgtt
gccatcaccctcggctgcgacttctgcctgtacggtccgatcgagcactccgtcgaggtc
ttccccgcagtcgccatgaacgacatcatcgtcgcagaggctgccaaggacctgggcact
gtgaccgtcgacgagcacccgctcaagaagctggtataa

DBGET integrated database retrieval system