KEGG   Methanocella arvoryzae: RCIX2158Help
Entry
RCIX2158          CDS       T00526                                 

Gene name
pcm
Definition
(GenBank) putative protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rci  Methanocella arvoryzae
Brite
Enzymes [BR:rci01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     RCIX2158 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_3 Fibrillarin GCD14 CMAS Methyltr_RsmB-F Methyltransf_25 RrnaAD DUF938 MTS Methyltransf_4 ACP_syn_III_C Methyltransf_11 Methyltransf_23 Methyltransf_24 Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: CAJ37283
UniProt: Q0W2W0
Position
complement(967106..967672)
Genome map
AA seq 188 aa AA seqDB search
MDRVPREEFVPEDVRPDAYYDTPLPIGHNQTISAPSMVAIMCQALDIREGNKVLEIGTGL
GYHAAVMAVLAGASGVVYTVERIPELADMARSVLSRLGFDNVKVFLRDGTEGLPDFAPYD
RISVAAAAPDVPQPLVDQLKDPGRLVIPVGRYFQQLMLVEKKGGQIITTDKGGVAFVPLL
GKYGFKGY
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggatcgggtgcctcgagaagagttcgtgccggaagatgtccggcccgacgcctattat
gatactccgctccctatcgggcataaccagacgatctcagccccaagtatggtggcgatc
atgtgccaggcgctcgacatccgggaagggaacaaagtcctcgaaatcggcacaggcctc
ggctaccacgctgccgtcatggccgtgctcgccggggcctccggcgttgtttacactgtc
gagcgcatacccgagctggctgacatggcccgatcggtcttgagccggctgggcttcgac
aacgttaaagtatttttacgcgatggcactgaaggcctccccgacttcgccccctacgac
cgaatcagcgtcgctgcagcggcccccgacgtcccgcagcctctggtagatcagctcaag
gacccaggtcgtttagttatccctgtaggccggtacttccagcagctcatgctcgtcgag
aaaaagggcggccagatcatcactaccgacaagggcggcgtggcattcgtgcccctgctg
gggaaatacgggtttaaagggtattag

DBGET integrated database retrieval system