KEGG   Methanocella arvoryzae: RCIX2237Help
Entry
RCIX2237          CDS       T00526                                 

Gene name
pfkB-1
Definition
ATP-dependent phosphofructokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rci  Methanocella arvoryzae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rci00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RCIX2237 (pfkB-1)
Enzymes [BR:rci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     RCIX2237 (pfkB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
892885..893805
Genome map
AA seq 306 aa AA seqDB search
MPRVILQTMCVKYDALCYGAISLDISGRVAGLAPGIQDSATDYEIYPGGDATLVALTLAG
LGWKVALAGGPVGKDPMGDYLRQRIAEAGIDLYADTRGKTSVSAVTVDRRGDRTSITFHE
DTPLNEIPVPVDLVSRSRSLYACGCYGENSARLGEKARAVKVPSVLNARADNLSFLGWFD
VAIASIANVRTLAKDPAEAAAILHAAGAGTAIVTAGEQGCAYCTTDTGILSAYKVDPVDC
TGAGAAFAAGFIHAGLQGLKLQDRLRYASAAGALKCLHRGSYRRLTQEELDHLVESWQVN
TNQTVA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
ttgccacgagtaatattacagacaatgtgcgtaaaatacgatgccctgtgctatggcgct
atatcgctagatatatccggccgggtagcagggctggccccgggcattcaggatagtgct
actgattatgagatttaccctggcggcgacgctacgctggtggccctgacactggccggt
ctgggatggaaagtagctctggcaggggggcccgtgggaaaagacccgatgggcgactac
ctccgccagagaatagcggaagctggcatcgatctgtatgcggacaccaggggaaagacg
agcgtttcggccgtcacagtcgaccgcaggggggaccggacctcgatcaccttccacgaa
gacacgcccctgaacgagatccccgtaccagtggatctggtatcccggtcccgcagcctt
tacgcctgcggatgctacggtgaaaactccgcccggctcggggaaaaggcgcgagctgtg
aaggtgccttcggtgctgaacgcaagggcggataacctcagctttctgggatggttcgac
gtcgccatagcgagcatagccaatgtcaggacccttgcgaaggaccctgcggaagcggcc
gccatcctgcatgccgcaggagcaggtacagcgatcgtaacagcaggagagcagggctgc
gcctattgtacgacagatacggggatattgtccgcatacaaggtcgatccagtcgattgc
acaggcgctggtgcggcctttgccgcaggcttcattcacgcaggcctccagggactgaag
ctgcaggacaggctaagatatgccagtgcagcgggggctctgaagtgcctgcacagagga
agctacaggcgattaacacaggaagagctggaccacttggtcgaatcatggcaggtaaat
acgaatcagaccgtagcttaa

DBGET integrated database retrieval system