KEGG   Methanocella arvoryzae: RCIX2268Help
Entry
RCIX2268          CDS       T00526                                 

Gene name
argI-2
Definition
putative arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
rci  Methanocella arvoryzae
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rci01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:rci00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
861175..862005
Genome map
AA seq 276 aa AA seqDB search
MASGTLTLVFPQWQGSGNSKATYYGAKYIKDNLLNGSCYREVPVGPDEGRQEKGINGYGH
ILSHLEGACEILRQETPDKVFLIGGDCGTELAPVSYLNKLYGGDLAVVWFDAHGDLNSPA
TSVSHNFHGMPLRCLLGDGDEALVKNCFSLLTPEQVIMAGIRELDPPEQKFIEEKNIDCV
TVDDIIADARKIARMVREKGYSNVYVHIDLDVLYPEKYPWVQCPCDNGIDMPELMAALTG
LKKELNIAGISLLELRPGDDMDASYLREPVSFCRSI
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggcatctggaactctaaccctggttttcccccagtggcagggctcggggaacagtaaa
gccacctactacggtgcgaagtacatcaaggataatctgctgaacggctcctgctaccgg
gaagtgccggtcggcccggacgagggccgacaggagaaggggatcaacggatacgggcat
atcctcagccatctcgaaggcgcatgtgagatactacgccaggaaactccggataaggta
tttctgataggaggggactgcggcaccgagctggcgcccgtctcttatttgaacaagctg
tacggcggcgatctggcggtggtatggttcgacgctcacggcgatctgaactcccctgca
acttccgtctcacacaatttccacggcatgccgctgagatgcctgctgggcgacggagat
gaggctctggtgaaaaactgtttttcgctcctgacgccggagcaggtgatcatggcgggg
atcagagagctggacccgccggagcagaagttcatcgaggaaaagaacatcgactgcgtc
actgtggacgacatcatagccgatgccaggaaaatagcccggatggtacgtgagaagggc
tacagcaatgtgtacgtacatatcgacctcgacgtcctgtaccctgaaaagtatccatgg
gtccagtgcccgtgcgataatggaatagatatgccggaactcatggcagctttaacgggc
ttgaaaaaagaactgaatattgccggcatcagcctccttgaattgaggcccggagacgat
atggatgcaagctacctccgggaaccggtcagcttctgccgctccatataa

DBGET integrated database retrieval system