KEGG   Methanocella arvoryzae: RCIX2268Help
Entry
RCIX2268          CDS       T00526                                 

Gene name
argI-2
Definition
(GenBank) putative arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
rci  Methanocella arvoryzae
Pathway
rci00220  Arginine biosynthesis
rci00330  Arginine and proline metabolism
rci01100  Metabolic pathways
rci01110  Biosynthesis of secondary metabolites
rci01130  Biosynthesis of antibiotics
rci01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rci00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    RCIX2268 (argI-2)
   00330 Arginine and proline metabolism
    RCIX2268 (argI-2)
Enzymes [BR:rci01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     RCIX2268 (argI-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: CAJ37379
UniProt: Q0W2L4
Position
861175..862005
Genome map
AA seq 276 aa AA seqDB search
MASGTLTLVFPQWQGSGNSKATYYGAKYIKDNLLNGSCYREVPVGPDEGRQEKGINGYGH
ILSHLEGACEILRQETPDKVFLIGGDCGTELAPVSYLNKLYGGDLAVVWFDAHGDLNSPA
TSVSHNFHGMPLRCLLGDGDEALVKNCFSLLTPEQVIMAGIRELDPPEQKFIEEKNIDCV
TVDDIIADARKIARMVREKGYSNVYVHIDLDVLYPEKYPWVQCPCDNGIDMPELMAALTG
LKKELNIAGISLLELRPGDDMDASYLREPVSFCRSI
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggcatctggaactctaaccctggttttcccccagtggcagggctcggggaacagtaaa
gccacctactacggtgcgaagtacatcaaggataatctgctgaacggctcctgctaccgg
gaagtgccggtcggcccggacgagggccgacaggagaaggggatcaacggatacgggcat
atcctcagccatctcgaaggcgcatgtgagatactacgccaggaaactccggataaggta
tttctgataggaggggactgcggcaccgagctggcgcccgtctcttatttgaacaagctg
tacggcggcgatctggcggtggtatggttcgacgctcacggcgatctgaactcccctgca
acttccgtctcacacaatttccacggcatgccgctgagatgcctgctgggcgacggagat
gaggctctggtgaaaaactgtttttcgctcctgacgccggagcaggtgatcatggcgggg
atcagagagctggacccgccggagcagaagttcatcgaggaaaagaacatcgactgcgtc
actgtggacgacatcatagccgatgccaggaaaatagcccggatggtacgtgagaagggc
tacagcaatgtgtacgtacatatcgacctcgacgtcctgtaccctgaaaagtatccatgg
gtccagtgcccgtgcgataatggaatagatatgccggaactcatggcagctttaacgggc
ttgaaaaaagaactgaatattgccggcatcagcctccttgaattgaggcccggagacgat
atggatgcaagctacctccgggaaccggtcagcttctgccgctccatataa

DBGET integrated database retrieval system