KEGG   Methanocella arvoryzae: RCIX2409Help
Entry
RCIX2409          CDS       T00526                                 

Gene name
pgm-2
Definition
phosphoglucomutase/phosphomannomutase (EC:5.4.2.2)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
rci  Methanocella arvoryzae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCIX2409 (pgm-2)
   00030 Pentose phosphate pathway
    RCIX2409 (pgm-2)
   00051 Fructose and mannose metabolism
    RCIX2409 (pgm-2)
   00052 Galactose metabolism
    RCIX2409 (pgm-2)
   00500 Starch and sucrose metabolism
    RCIX2409 (pgm-2)
   00520 Amino sugar and nucleotide sugar metabolism
    RCIX2409 (pgm-2)
  Nucleotide metabolism
   00230 Purine metabolism
    RCIX2409 (pgm-2)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RCIX2409 (pgm-2)
Enzymes [BR:rci01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     RCIX2409 (pgm-2)
    5.4.2.8  phosphomannomutase
     RCIX2409 (pgm-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(746239..747570)
Genome map
AA seq 443 aa AA seqDB search
MALFGTNGVRGIANVEMTPEMAMNLAKSIGTLKGGKIAVGRDTRQSGEMLKSAVIAGLLS
TGCSVVDLGIAPTPTVQYYVKHHADAGIIITASHNPPEYNGVKGVAGDGTEMSRADEAEV
EKIYFSGSYRQANWSQTGELSSFDPKPMYIDGIIKAVDAEAIRKKNFKVVSDTGCGAASL
TTPFLLRKLNCKVISLNAQVDGTFPGRNPEPTGNEINDLKAAVVAAGADMGIAHDADADR
AVFVDDKGRFVNEDVLLAMMTEYKLQRKPGTIVTPVSSSSLIEDIAKKYGQEVIWTQVGS
IHVARKMMQVGAVFGGEGNGGLIYPEFQYCRDGGMSAASVLEMLATTGKKLSEIVDAVPC
YNSVKEKIHCKNKNEVLKMIATHAKGDKIDTTDGVKIFNNDGWVLVRASGTEPIIRVFAE
SKTCDGAKRLAEYGVSLVTEYNK
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggcattatttggcactaacggagtcaggggtatcgcgaacgtggagatgacacctgag
atggcgatgaacctggcgaagagtatcggcacgctcaagggcggtaagatcgcagtaggg
cgggacacccgccagtccggcgagatgctcaagagcgccgtcatcgcggggctgctctcc
actggctgcagcgtggtagatctgggcatcgcacccacgccgaccgtccagtattacgtg
aagcaccacgcagatgcgggcatcatcatcaccgcctcccacaaccctcccgagtacaac
ggtgtcaaaggcgtcgcaggcgacggcacggaaatgtcgagggctgacgaggctgaagtg
gagaagatctacttctcgggcagctacaggcaggcgaactggagccagactggcgagctg
tccagcttcgacccgaagcctatgtacatcgacggcatcatcaaggccgtcgacgcggaa
gcgatcagaaagaagaacttcaaggtcgtctccgataccggttgcggagcggccagcctg
accacgcccttcctgctgaggaagctgaactgtaaagtcatatcgctcaacgcccaggtc
gacggcaccttcccgggcaggaacccggaacccaccggcaacgagatcaatgacctgaaa
gcagcggtagtcgcagccggcgccgacatgggcatcgcccacgatgcagacgcagaccgg
gcagttttcgtggatgacaagggcaggttcgtcaatgaggacgtactgctggccatgatg
acggagtacaaattacagcgcaagcccggcactatcgttactccggtcagctcttcctcc
ctcatcgaggacattgcgaagaagtacggccaggaagtcatctggactcaggtgggcagc
atccacgtagcccgaaagatgatgcaggtcggcgcagtcttcggcggagagggcaacggc
ggcctgatctatccggaattccagtactgccgggacggcggcatgtccgcggcctcggtg
ctcgaaatgctggccacgaccggtaagaagctgagcgaaatcgtcgatgcagtgccctgc
tataacagcgttaaggagaagatccactgcaagaacaagaatgaagtcctgaagatgatc
gccacccacgcgaagggcgataagatcgacactaccgacggcgtcaagatcttcaataat
gatggctgggtgctcgtccgggcttccggcacggagccgatcatccgggtctttgctgaa
tcgaagacttgtgatggtgcgaagaggctggctgagtatggcgtcagcctggtgaccgag
tacaataaataa

DBGET integrated database retrieval system