KEGG   Methanocella arvoryzae: RCIX2409Help
Entry
RCIX2409          CDS       T00526                                 

Gene name
pgm-2
Definition
(GenBank) phosphoglucomutase/phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
rci  Methanocella arvoryzae
Pathway
rci00010  Glycolysis / Gluconeogenesis
rci00030  Pentose phosphate pathway
rci00051  Fructose and mannose metabolism
rci00052  Galactose metabolism
rci00230  Purine metabolism
rci00500  Starch and sucrose metabolism
rci00520  Amino sugar and nucleotide sugar metabolism
rci00521  Streptomycin biosynthesis
rci01100  Metabolic pathways
rci01110  Biosynthesis of secondary metabolites
rci01120  Microbial metabolism in diverse environments
rci01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCIX2409 (pgm-2)
   00030 Pentose phosphate pathway
    RCIX2409 (pgm-2)
   00051 Fructose and mannose metabolism
    RCIX2409 (pgm-2)
   00052 Galactose metabolism
    RCIX2409 (pgm-2)
   00500 Starch and sucrose metabolism
    RCIX2409 (pgm-2)
   00520 Amino sugar and nucleotide sugar metabolism
    RCIX2409 (pgm-2)
  Nucleotide metabolism
   00230 Purine metabolism
    RCIX2409 (pgm-2)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RCIX2409 (pgm-2)
Enzymes [BR:rci01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     RCIX2409 (pgm-2)
    5.4.2.8  phosphomannomutase
     RCIX2409 (pgm-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV Methyltransf_29
Motif
Other DBs
NCBI-ProteinID: CAJ37497
UniProt: Q0W296
Position
complement(746239..747570)
Genome map
AA seq 443 aa AA seqDB search
MALFGTNGVRGIANVEMTPEMAMNLAKSIGTLKGGKIAVGRDTRQSGEMLKSAVIAGLLS
TGCSVVDLGIAPTPTVQYYVKHHADAGIIITASHNPPEYNGVKGVAGDGTEMSRADEAEV
EKIYFSGSYRQANWSQTGELSSFDPKPMYIDGIIKAVDAEAIRKKNFKVVSDTGCGAASL
TTPFLLRKLNCKVISLNAQVDGTFPGRNPEPTGNEINDLKAAVVAAGADMGIAHDADADR
AVFVDDKGRFVNEDVLLAMMTEYKLQRKPGTIVTPVSSSSLIEDIAKKYGQEVIWTQVGS
IHVARKMMQVGAVFGGEGNGGLIYPEFQYCRDGGMSAASVLEMLATTGKKLSEIVDAVPC
YNSVKEKIHCKNKNEVLKMIATHAKGDKIDTTDGVKIFNNDGWVLVRASGTEPIIRVFAE
SKTCDGAKRLAEYGVSLVTEYNK
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggcattatttggcactaacggagtcaggggtatcgcgaacgtggagatgacacctgag
atggcgatgaacctggcgaagagtatcggcacgctcaagggcggtaagatcgcagtaggg
cgggacacccgccagtccggcgagatgctcaagagcgccgtcatcgcggggctgctctcc
actggctgcagcgtggtagatctgggcatcgcacccacgccgaccgtccagtattacgtg
aagcaccacgcagatgcgggcatcatcatcaccgcctcccacaaccctcccgagtacaac
ggtgtcaaaggcgtcgcaggcgacggcacggaaatgtcgagggctgacgaggctgaagtg
gagaagatctacttctcgggcagctacaggcaggcgaactggagccagactggcgagctg
tccagcttcgacccgaagcctatgtacatcgacggcatcatcaaggccgtcgacgcggaa
gcgatcagaaagaagaacttcaaggtcgtctccgataccggttgcggagcggccagcctg
accacgcccttcctgctgaggaagctgaactgtaaagtcatatcgctcaacgcccaggtc
gacggcaccttcccgggcaggaacccggaacccaccggcaacgagatcaatgacctgaaa
gcagcggtagtcgcagccggcgccgacatgggcatcgcccacgatgcagacgcagaccgg
gcagttttcgtggatgacaagggcaggttcgtcaatgaggacgtactgctggccatgatg
acggagtacaaattacagcgcaagcccggcactatcgttactccggtcagctcttcctcc
ctcatcgaggacattgcgaagaagtacggccaggaagtcatctggactcaggtgggcagc
atccacgtagcccgaaagatgatgcaggtcggcgcagtcttcggcggagagggcaacggc
ggcctgatctatccggaattccagtactgccgggacggcggcatgtccgcggcctcggtg
ctcgaaatgctggccacgaccggtaagaagctgagcgaaatcgtcgatgcagtgccctgc
tataacagcgttaaggagaagatccactgcaagaacaagaatgaagtcctgaagatgatc
gccacccacgcgaagggcgataagatcgacactaccgacggcgtcaagatcttcaataat
gatggctgggtgctcgtccgggcttccggcacggagccgatcatccgggtctttgctgaa
tcgaagacttgtgatggtgcgaagaggctggctgagtatggcgtcagcctggtgaccgag
tacaataaataa

DBGET integrated database retrieval system