KEGG   Methanocella arvoryzae: RCIX2428Help
Entry
RCIX2428          CDS       T00526                                 

Gene name
asnB-2
Definition
putative asparagine synthetase, glutamine-hydrolyzing (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rci  Methanocella arvoryzae
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:rci00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(732759..734117)
Genome map
AA seq 452 aa AA seqDB search
MCGIAGFVGEKARQRTCQMIEALKHRGPDGLAVQELGDACLGHAHLKVTGDFPQPVTAGN
VTFVYNGEIYNHSDFLPGSTSDTEVLASILKAGIAGFESAAPKIDGEYAFAARDGSHITL
VRDPLGIKPLYYGCSEAGFGFASERKALMRVGIRDIRSLSPGCMLAEGRERRFADLPPMQ
PAIVDEQEAVRLLDEALSRAVWLRLHKDAAVTFSGGIDSALIGAMAPDTPLLTVGLPGSF
DVKAAIHAARAIGAEHRHTVYEVTEKDVEEALPGVIYAIESASPVSVSIALPLYILSARA
RADGYKVLLSGQGSDELFAGYARYEAGYVESRLQEMLDHDQRHLAEVNLERDDAAAMASG
VELRVPYLDLAVVSLARQLDPSLKLRVNGKDYIRKYVLRKVAENYFPPDVSGAPKKAIQY
GTGIQKTLERLARSHGCDLAGYLQTLYKVVLV
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatagccggctttgtcggcgaaaaggcaagacagcgaacctgtcagatgatc
gaggccctcaagcatcgcggccctgacgggctggcggtgcaggaactcggagacgcctgc
ctcggccacgcgcacctgaaagtcacaggcgactttcctcagccggtcactgccggtaac
gtcaccttcgtctataacggcgagatatacaaccactccgattttctgcccgggagcacg
tctgacactgaagtgctggcgtcgatactaaaagctggcatagcgggcttcgagagcgca
gccccgaagatcgacggcgagtacgcgttcgccgcccgggatggtagccacatcacgctc
gtcagagatccgctgggcatcaagccgctctactatggctgctcggaagccggcttcggc
tttgcctcagagcgtaaggcgctcatgcgagtcggcatccgggacatcaggtcgctgtcg
ccgggttgtatgctggccgaaggccgagagcgcaggttcgcagaccttcccccgatgcag
ccggccatcgtggacgagcaggaggccgtccggctgctggatgaagcgctcagccgggcc
gtctggctgcggttacacaaagatgctgcagtcacgttctccgggggcatcgacagcgcg
ctgatcggcgccatggcacctgatactccacttttgaccgtaggcctgcccgggtcgttc
gacgtcaaagcagccatacacgccgccagagccataggcgcagaacaccggcatacagtc
tacgaggtcacagaaaaagacgtggaagaggcgttgccaggcgttatctacgccatcgag
agcgccagcccggtctcagtctctatcgcattgccactctatatattatctgcgcgggcc
cgggctgacgggtataaagtactcctgtccggccagggctccgacgagctgtttgccggc
tatgcccggtacgaagccggatatgtagaaagtcggctccaggagatgctcgaccacgac
cagcgtcatctcgccgaagtaaatctcgagcgggacgacgccgcagctatggcctccggc
gtcgaactccgggtcccgtatctcgacctcgcagtcgtaagtcttgcccggcagctcgac
ccctctctgaagctacgagttaatggcaaggattatatacggaaatatgttctaagaaaa
gtagcggaaaattacttcccgccagatgtatctggtgcgcccaagaaggccatccagtat
ggcactggcatccagaagacgctggaacggctggcccggagccacggttgtgatctggcc
ggctatttacagacactctacaaggttgtgcttgtatga

DBGET integrated database retrieval system