KEGG   Methanocella arvoryzae: RCIX2629Help
Entry
RCIX2629          CDS       T00526                                 

Gene name
ruvA
Definition
holliday junction resolvasome, DNA-binding subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rci  Methanocella arvoryzae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rci00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RCIX2629 (ruvA)
Enzymes [BR:rci01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     RCIX2629 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(603511..604116)
Genome map
AA seq 201 aa AA seqDB search
MIAHIEGKIDAKSESEEVVVIEAGGIGYEVHVPTPVLDQLPQEGEDCKLYIHTNFREEDG
TTLYGFATIQDRDFFRLLLTVSGIGPKVGLGIMSGATVEEIAEAIVTEDLKTLTRMNGVG
KKTAQRLVLELKDKVAKLRIMHHAKKQVKGDTASADAVDALVALGYSRQVASDAVARARD
NFTAPPLVNELVVASLRYAAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatagcacatatcgaaggcaaaatcgacgctaagtccgaatccgaagaggtcgtcgtc
atcgaagccgggggcatcggctacgaagtacacgtgccgacaccagtactagatcagcta
ccgcaggaaggagaggactgcaagctttatattcacaccaacttccgggaagaagacggc
actaccctgtacggcttcgctactatacaggaccgggatttcttccggctgctgctcacc
gtatcaggcatcgggcccaaagtcggcctgggcatcatgtccggcgccaccgttgaagag
atcgccgaagccatcgtgaccgaagacctgaagacgctgacccgcatgaacggcgtaggc
aagaagaccgctcagaggctggtcctcgaattgaaggataaggtggctaagttgcgcatc
atgcaccatgccaagaagcaggtgaagggcgacactgcctccgctgatgcagtggatgcc
cttgtggcgctgggctatagcagacaggtcgcctctgacgcggtggccagggcaagagac
aacttcacggcgccgccgctggtaaatgagctggtcgtagcctcgctgcggtacgcggct
aaatag

DBGET integrated database retrieval system