KEGG   Methanocella arvoryzae: RCIX2635Help
Entry
RCIX2635          CDS       T00526                                 

Definition
(GenBank) tryptophan synthase, beta chain-like
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rci  Methanocella arvoryzae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rci00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RCIX2635
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RCIX2635
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RCIX2635
Enzymes [BR:rci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RCIX2635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
598943..600244
Genome map
AA seq 433 aa AA seqDB search
MIRVNLDSDEVPDRWYNIVPDLPEKLPPAIHPGTREPLKPEEWEGLFPKALVRQELSEER
YIRIPEEVREALITIGRPSPLYRARRLEKALGTPARIYFKREDLSPAGSHKPNTAIAQAY
YNMAEGVENLTTETGAGQWGSALSSACALYGLKCTVFMVRSSYDSKPYRKFVMKMFGADV
YASPSNVTEFGRKVNREDPTCSGSLGIAISEAVEMAVKGEKTKYALGSVLNHVMLHQTVI
GLEAQKQLEKIGEKPDTLIACVGGGSNFAGFTFPFIHDKQKGKNDAKFIAVEPQSVPSLT
GMKSGESKYDYDFGDTAGMTPMLKMHSLGHDFMPRVIHAGGLRYHGMSPLVSLLYKNNVI
EAEALHQAETFAAGKLFAETEGIIAAPESCHAIASAINHARAAKKANEEKVIVFNLSGHG
LLDLQNYADMLKF
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtgataagagtcaacctcgactccgacgaagtccccgaccgctggtataacatagtcccg
gacctccctgaaaagctcccgcccgccatccacccgggcaccagggagccgctaaagccg
gaagagtgggaaggcctgttccctaaggcactggtcaggcaggagctgtcagaggagcgc
tacatccggatacctgaagaagtcagagaagccttgatcaccatcggcaggccgtcgccc
ctgtaccgggcccgcaggctcgagaaggcgctgggcaccccggccaggatctacttcaag
agggaagacctgtccccggcaggctcgcacaagcccaacacagccatcgcccaggcttac
tacaacatggcagaaggcgtggagaacctgactacggagactggcgcaggccagtggggc
tctgccctgagctccgcttgcgccctctacgggctgaagtgcacagttttcatggtccgc
tccagctacgacagcaagccttaccgcaagttcgtcatgaagatgttcggcgccgacgta
tacgcgtctccgagcaacgtcaccgagttcggccggaaagtcaatcgggaagacccgact
tgcagcgggagtctgggcatcgccatcagcgaagccgtcgagatggcggtgaaaggcgag
aagacgaagtacgcgctgggcagcgtgctcaaccacgtcatgctccaccagacagtcatc
ggcctggaagcccagaagcagctggaaaagatcggggagaagccggacactttgatagcc
tgcgtgggcggcggcagcaacttcgccggatttacattcccgttcatccacgataagcag
aaaggcaagaacgacgcgaagttcatcgctgtcgagccgcagagcgttccatcgctcaca
gggatgaagagcggcgagtcgaagtacgactacgatttcggcgataccgcaggcatgacc
ccgatgctcaagatgcacagcctcggccacgacttcatgcccagagtcatccatgcgggc
ggcctcaggtaccatggcatgtcccctctcgtatccctgctgtacaagaacaatgtcatc
gaagccgaagccctgcaccaggccgagacattcgccgccggcaagctgttcgcggagaca
gaaggcatcatcgccgcaccggagtcctgccatgccatcgcctccgccatcaaccacgcg
agagcggcgaagaaggccaacgaggagaaggtcatagtattcaacctcagcggccacggg
ctgctggacctgcagaactatgcggacatgctgaagttttag

DBGET integrated database retrieval system