KEGG   Methanocella arvoryzae: RCIX490Help
Entry
RCIX490           CDS       T00526                                 

Gene name
porB-1
Definition
pyruvate:ferredoxin oxidoreductase, beta subunit (EC:1.2.7.1)
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
rci  Methanocella arvoryzae
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RCIX490 (porB-1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCIX490 (porB-1)
   00020 Citrate cycle (TCA cycle)
    RCIX490 (porB-1)
   00620 Pyruvate metabolism
    RCIX490 (porB-1)
   00640 Propanoate metabolism
    RCIX490 (porB-1)
   00650 Butanoate metabolism
    RCIX490 (porB-1)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    RCIX490 (porB-1)
   00680 Methane metabolism
    RCIX490 (porB-1)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    RCIX490 (porB-1)
Enzymes [BR:rci01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     RCIX490 (porB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2299300..2300229)
Genome map
AA seq 309 aa AA seqDB search
MAALEDLFASGHRACAGCGCALFLKTLLRVTGPDVIITNATGCMEVVSTPYPESAWKVPW
IHSLFENSGPVAAGIEAALKATGRKGNTKVIALGGDGGTIDIGFGNLSGVMERGHDILYI
CYDNEAYMNTGIQRSGSTPYDANTTTTPSGKISFGNQRPKKNAPAIMAAHGIPYVATTSI
GYPADFTKKIRKALTIEGPKYIQVHATCTPGWGIDSALSIEILRLAVETGLYPLYEYENG
QITSVKKIKDRKPVKEYLDKQKRFSHLFKMPGGDKEIEKIQHIADLNAKHFGLDIEPSKP
AAAAPKKVE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggcggcacttgaagacctgttcgcatcgggccacagggcctgcgccggctgcggctgc
gctctgttcctgaaaactctgctgagggtgaccggccccgacgtgatcatcaccaacgcg
accggctgcatggaagtcgtctcgactccataccctgagtccgcgtggaaagtaccctgg
atccactcgctgttcgagaactccggacctgtagcggccggcatcgaagcggcgctcaag
gccacgggaagaaaaggcaacactaaagtgattgcgctcggcggcgacggcggcaccatc
gacatcgggttcggcaatctgtcgggtgtcatggaacgcggccacgacatcctgtacatc
tgctacgacaacgaggcgtacatgaacacgggcatccagcgcagcggctccaccccgtac
gatgccaacacgaccaccaccccgtcaggcaagatctccttcggcaaccagcggcccaag
aagaacgccccggctatcatggccgcccacggcattccctacgtggccaccacttcgata
ggatatccggcggacttcactaaaaagatacgcaaggcgttaactatagagggcccgaag
tacatccaggtccacgcgacctgtacgccgggctggggcatcgacagcgcgctgtccatc
gaaatcctccgcctggcagtcgagaccggactgtacccgttatacgagtacgagaacggc
cagatcaccagcgtcaagaaaatcaaggaccggaagcccgtaaaagagtacctcgacaag
cagaagcggttctcccacctgttcaagatgcctggcggcgacaaggaaattgaaaagatc
cagcacatcgccgacctcaacgcgaagcacttcgggctcgacatagagccgtcaaagccc
gcagctgccgctccgaagaaggtggaataa

DBGET integrated database retrieval system