KEGG   Methanocella arvoryzae: RCIX662Help
Entry
RCIX662           CDS       T00526                                 

Gene name
moeA-2
Definition
molybdopterin biosynthesis protein A
Orthology
K03750  
molybdopterin molybdotransferase [EC:2.10.1.1]
Organism
rci  Methanocella arvoryzae
Brite
Enzymes [BR:rci01000]
 2. Transferases
  2.10  Transferring molybdenum- or tungsten-containing groups
   2.10.1  Molybdenumtransferases or tungstentransferases with sulfide groups as acceptors
    2.10.1.1  molybdopterin molybdotransferase
     RCIX662 (moeA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2147399..2148607
Genome map
AA seq 402 aa AA seqDB search
MPLKSGFQTKTSIDKALDIFLSSFEPLAAVEQVTIEECDGRVLSADILSPRDVPHYDRSA
MDGYAVRAEDTFGGSRDAGIMLRLVTGERIGPGECRQVHTGSPLPEGADAVVMVEHTETA
GDSIEVLGQVSPGQNVGLRGEDVRKGDLVFRQGRQLKPSDAGLLASMGLQQVEVYRLPRV
MIIPTGEEIVPRGTEPLPGQMNESNGVMNCLYVRRYGGVPTVHDIVVDDRDKIREALKEA
TAYDLIVTTGGSSVGKRDLLAEVVASVGKVLVHGVAIKPGRPVALGYVETAGKRTPIVCL
PGYPAACAIDSIVFVDPAVKKLGHYPAARYRTERAVLTRKIPSEAGYRTYTRVSVEDGKA
TPLRTKGAGILSSVSLADGYVIVPEDLEGYDSGETVEVVYLE
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgaaatctggcttccagaccaagacgagcatcgacaaagccctcgatattttc
ctgagctccttcgagcccctcgccgccgtagagcaggtaacgatcgaagaatgtgacggc
cgcgtcctttcggcggacattctctctcccagggacgtgccccactacgaccggagcgcg
atggacggctacgcggtccgggcggaggacaccttcggcggcagccgggacgccggcatc
atgctcaggctggtcaccggagagcggatcggccccggcgagtgcaggcaggtccacacc
ggcagccccctcccggaaggcgccgacgccgtggtcatggtggagcacaccgagacagcg
ggcgactccatagaggtgctcggacaggtgtcccccgggcagaacgtgggcctcagaggc
gaggacgtgcgcaagggagacttagttttcaggcagggccggcagctcaagccgtccgac
gcaggcctgctggcttccatgggcctgcagcaggtcgaagtctaccgcctccccagggtc
atgatcataccgaccggagaggagatcgtgccccggggcaccgagccactcccgggccag
atgaacgagagcaacggcgtcatgaactgcctgtacgtgaggcggtacggaggagtgccc
acggtccacgatatcgtagtggacgaccgggataagatccgggaagcgctgaaagaagcc
acagcctacgatttgatagtcaccaccggcggcagttcggtgggcaaacgggacctgctc
gcagaggtcgtggcatcagtcggcaaggtgctcgtccacggcgtggccatcaagcccggc
cgcccggtggcgctgggctacgtcgaaactgcgggcaagcggacgcccatcgtctgcctt
cccggctacccggcggcatgcgccatcgactccatagtcttcgtagatccggccgtgaag
aagctgggccactatcccgcagccaggtacagaactgagcgggcagtccttacgaggaaa
attccgtctgaggccggctaccggacctacacccgcgtctccgtcgaagacggcaaggcc
acccctctccgcactaaaggcgcgggcattctcagctccgtctccctggcagacgggtac
gtgatcgtgcccgaggacctggaaggctacgattcaggcgagaccgtggaggtcgtttac
cttgagtaa

DBGET integrated database retrieval system