KEGG   Methanocella arvoryzae: RCIX770Help
Entry
RCIX770           CDS       T00526                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rci  Methanocella arvoryzae
Pathway
rci00010  Glycolysis / Gluconeogenesis
rci00051  Fructose and mannose metabolism
rci00562  Inositol phosphate metabolism
rci01100  Metabolic pathways
rci01110  Biosynthesis of secondary metabolites
rci01120  Microbial metabolism in diverse environments
rci01130  Biosynthesis of antibiotics
rci01200  Carbon metabolism
rci01230  Biosynthesis of amino acids
Module
rci_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:rci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCIX770 (tpi)
   00051 Fructose and mannose metabolism
    RCIX770 (tpi)
   00562 Inositol phosphate metabolism
    RCIX770 (tpi)
Enzymes [BR:rci01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RCIX770 (tpi)
Exosome [BR:rci04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RCIX770 (tpi)
  Exosomal proteins of bladder cancer cells
   RCIX770 (tpi)
  Exosomal proteins of melanoma cells
   RCIX770 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM NMO ThiG FMN_dh His_biosynth Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: CAJ36145
UniProt: Q0W648
Position
2062471..2063157
Genome map
AA seq 228 aa AA seqDB search
MPAKEPVIILNYKTYTESMGEQGRKLTWMAMEVMKETGVRIVACPQLPEMYHHKNLDIEI
FAQHVDPIEPGGHTGHILPEALKCAGATGTLINHSEDRMPADQIRKCVELCRKHGLTSVV
CAESVEKVKEVAAFKPDYIAIEPPELIGSGIPVSKANPDIVRNSVNAVTDPEIKVLCGAG
ISTGDDVKAALALGTHGVLLASGVVKAKDPKKALYDLVSLIAPKTVTG
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccagcgaaggaacccgtcatcatcctcaattacaagacttacacggagagcatgggc
gagcagggccggaagctcacctggatggccatggaggtcatgaaggagaccggcgtccgg
atcgtcgcctgcccgcagctgcccgaaatgtaccatcacaagaacctggatattgaaatt
ttcgcccagcacgtcgaccccatcgagccgggcggccacaccgggcacatcctgcccgag
gccctgaaatgcgccggcgccaccggaacgctgatcaaccactccgaggaccggatgccc
gccgaccagatcaggaagtgcgtggagctgtgccgcaagcacgggctgacctctgtcgta
tgtgccgagagcgtcgagaaggtcaaagaagtcgcagccttcaagcccgactatatcgcc
atcgagccgcccgagctcatcggcagcggcatacccgtatcaaaagccaaccccgacatc
gtccgcaactccgtaaatgcggtcaccgaccccgagatcaaggtgctctgcggcgcgggc
atcagcaccggcgacgacgtcaaggcagcgctggcgctcggcactcatggcgtgctgcta
gcgtcgggcgtggtcaaggcaaaggacccaaagaaggcgctctacgatctagtgtcgctg
atcgcgcccaaaaccgtgacaggctaa

DBGET integrated database retrieval system