KEGG   Methanocella arvoryzae: RCIX770Help
Entry
RCIX770           CDS       T00526                                 

Gene name
tpi
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rci  Methanocella arvoryzae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:rci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RCIX770 (tpi)
   01230 Biosynthesis of amino acids
    RCIX770 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCIX770 (tpi)
   00051 Fructose and mannose metabolism
    RCIX770 (tpi)
   00562 Inositol phosphate metabolism
    RCIX770 (tpi)
Enzymes [BR:rci01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RCIX770 (tpi)
Exosome [BR:rci04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RCIX770 (tpi)
  Exosomal proteins of bladder cancer cells
   RCIX770 (tpi)
  Exosomal proteins of melanoma cells
   RCIX770 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2062471..2063157
Genome map
AA seq 228 aa AA seqDB search
MPAKEPVIILNYKTYTESMGEQGRKLTWMAMEVMKETGVRIVACPQLPEMYHHKNLDIEI
FAQHVDPIEPGGHTGHILPEALKCAGATGTLINHSEDRMPADQIRKCVELCRKHGLTSVV
CAESVEKVKEVAAFKPDYIAIEPPELIGSGIPVSKANPDIVRNSVNAVTDPEIKVLCGAG
ISTGDDVKAALALGTHGVLLASGVVKAKDPKKALYDLVSLIAPKTVTG
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccagcgaaggaacccgtcatcatcctcaattacaagacttacacggagagcatgggc
gagcagggccggaagctcacctggatggccatggaggtcatgaaggagaccggcgtccgg
atcgtcgcctgcccgcagctgcccgaaatgtaccatcacaagaacctggatattgaaatt
ttcgcccagcacgtcgaccccatcgagccgggcggccacaccgggcacatcctgcccgag
gccctgaaatgcgccggcgccaccggaacgctgatcaaccactccgaggaccggatgccc
gccgaccagatcaggaagtgcgtggagctgtgccgcaagcacgggctgacctctgtcgta
tgtgccgagagcgtcgagaaggtcaaagaagtcgcagccttcaagcccgactatatcgcc
atcgagccgcccgagctcatcggcagcggcatacccgtatcaaaagccaaccccgacatc
gtccgcaactccgtaaatgcggtcaccgaccccgagatcaaggtgctctgcggcgcgggc
atcagcaccggcgacgacgtcaaggcagcgctggcgctcggcactcatggcgtgctgcta
gcgtcgggcgtggtcaaggcaaaggacccaaagaaggcgctctacgatctagtgtcgctg
atcgcgcccaaaaccgtgacaggctaa

DBGET integrated database retrieval system