KEGG   Methanocella arvoryzae: RCIX793Help
Entry
RCIX793           CDS       T00526                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rci  Methanocella arvoryzae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rci00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RCIX793 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RCIX793 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RCIX793 (trpA)
Enzymes [BR:rci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RCIX793 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2045019..2045840
Genome map
AA seq 273 aa AA seqDB search
MTSRRNMKLSEKFAELRRNGEGALVAYITMGDPSPVESLAIAQSLIDSGAVDVLELGVPF
SDPIADGPVIQNAVDRALRAGMNTDLAFEISAQLDKKVPIVYLTYYNIVLQYGVKRFFES
CQKSGISGVIIADLPYEEGAEVRQACADNGVDYIHIVTPNTSAERMQMILAESSGFAYLV
STRGVTGKRASLSAGIKEVLDRAKAAAGNTPVAVGFGISGPDHVTEIISMGADGAIVGSA
IVDLIAKGATTEELQAYVRSLKQATRTVRAVVE
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcgagaagaaatatgaagctgtccgaaaaattcgccgagctgcgccgcaacggg
gagggcgcccttgtcgcctacatcaccatgggagacccctccccggtagagtctctcgcc
atagcgcagtcgctcatcgactcaggcgcggtagacgtgctggagctgggcgtgccattc
tccgatccgatagcagacgggccggtcatccagaacgccgtcgacagagcgctgagggcc
ggcatgaacactgaccttgctttcgagatctcggcgcagcttgacaagaaagtgcccatc
gtgtacctgacgtactacaacatcgtgctccagtacggggtaaagagattcttcgaatcc
tgccaaaaatcgggcatttccggcgtgatcatcgccgatctgccctacgaggaaggtgcg
gaagtccggcaggcatgcgcggacaacggcgtggactacatccacatcgtcacgcccaac
acgagcgcggagcgcatgcagatgatcctggccgagtcgtcgggcttcgcctaccttgtc
tccaccagaggtgtcaccggcaagcgcgccagcctctctgccggcataaaggaagtcctc
gaccgggccaaagcagccgcaggcaacacccctgtagcagtcggcttcggcatctccggc
cccgaccacgtcaccgagatcatatccatgggcgccgacggcgccatcgtcggcagcgcc
atcgtggaccttatagcgaagggtgccaccaccgaggaattgcaggcgtacgtccgcagc
ctcaaacaggctaccagaaccgtcagggccgtcgtggaataa

DBGET integrated database retrieval system