KEGG   Methanocella arvoryzae: RCIX794Help
Entry
RCIX794           CDS       T00526                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rci  Methanocella arvoryzae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rci00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RCIX794 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RCIX794 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RCIX794 (trpB)
Enzymes [BR:rci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RCIX794 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2043847..2045019
Genome map
AA seq 390 aa AA seqDB search
MTEGRYGEYGGTYVPEMLVPALKDVDAGYKRYRNDPAFREELDAYMKEFVGRPTPLTKSR
NMSRKYGFTLYLKREDQAFTGAHKINNTIGQALLAKRMGKTRLIAETGAGQHGVATATAA
RALGMKCTIYMGEVDIERQKMNVFRMRLLGAEVVSVKNGTRTLKDAISEAMRSWVTCLDD
THYLFGTAYGPHPYPEMVKDFQSVIGKEAREQVLNQEGRLPDAVVACVGGGSNAIGIFSG
FIPDESVRLIGVEAGGCGIESGRHAARFQTGTKGVLHGSYTYVLQDRYGQISDTHSVSAG
LDYAAVGPEHALLRDLKRAEYSYCTDDEALFGFQELGMVEGILPALESSHAVGYVIKNRK
QFQGQTVIVNLSGRGDKDVYTVARCMGVDI
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgacagagggaaggtatggggagtacggcggcacctacgtgccggagatgctggtcccg
gcgctgaaagacgtcgacgcaggctacaagagatacaggaacgatccggcgttccgggaa
gagctcgacgcttacatgaaggagttcgtgggcaggcccacacccctgacgaagtccagg
aacatgagccggaagtacggcttcactctctatttgaagagggaggaccaggccttcacc
ggcgctcataaaataaacaacaccatcgggcaggctctgctggcgaagcggatgggcaag
acccggctgatcgccgaaaccggggcaggccagcacggcgtcgctaccgcaacggcggcg
agggcgctgggcatgaagtgcacgatttacatgggtgaggtcgacatcgagcggcagaag
atgaacgtgttcaggatgcggctgctcggcgccgaagtagtatctgtcaagaacggcacc
cgcactttaaaagacgcgatcagcgaagccatgcggtcctgggtcacctgtctggacgac
acccactacctgttcggcaccgcatacggcccccacccataccctgaaatggtcaaggac
ttccagagtgtcattggcaaagaggccagagagcaggtgctgaatcaggaaggcaggctg
ccagatgcagtcgtcgcctgcgtgggcggaggcagcaacgcgatcgggatattttccggg
ttcatacccgatgaaagcgtccgcctgatcggcgtggaagccggcggctgcggtattgaa
agcggcaggcacgcggcccggttccagaccggcaccaaaggcgttctccacggctcatac
acttacgtgctgcaggacaggtacggacagatctcggacacccacagcgtttctgctggt
ttggactatgccgccgtaggccccgagcacgctttactgagggatctaaagagagcagaa
tacagctactgcaccgacgacgaggcactgttcggattccaggagctgggcatggtggaa
ggcatcctgcccgcgctggaatcctcgcatgcagtgggttacgtaatcaagaacaggaag
cagttccagggccagacggtcatcgtcaacctgtccggcagaggagacaaggacgtgtac
actgtagccaggtgcatgggggtcgacatctga

DBGET integrated database retrieval system