KEGG   Methanocella arvoryzae: RCIX794Help
Entry
RCIX794           CDS       T00526                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rci  Methanocella arvoryzae
Pathway
rci00260  Glycine, serine and threonine metabolism
rci00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rci01100  Metabolic pathways
rci01110  Biosynthesis of secondary metabolites
rci01130  Biosynthesis of antibiotics
rci01230  Biosynthesis of amino acids
Module
rci_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rci00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RCIX794 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RCIX794 (trpB)
Enzymes [BR:rci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RCIX794 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DFP
Motif
Other DBs
NCBI-ProteinID: CAJ36164
UniProt: Q0W629
Position
2043847..2045019
Genome map
AA seq 390 aa AA seqDB search
MTEGRYGEYGGTYVPEMLVPALKDVDAGYKRYRNDPAFREELDAYMKEFVGRPTPLTKSR
NMSRKYGFTLYLKREDQAFTGAHKINNTIGQALLAKRMGKTRLIAETGAGQHGVATATAA
RALGMKCTIYMGEVDIERQKMNVFRMRLLGAEVVSVKNGTRTLKDAISEAMRSWVTCLDD
THYLFGTAYGPHPYPEMVKDFQSVIGKEAREQVLNQEGRLPDAVVACVGGGSNAIGIFSG
FIPDESVRLIGVEAGGCGIESGRHAARFQTGTKGVLHGSYTYVLQDRYGQISDTHSVSAG
LDYAAVGPEHALLRDLKRAEYSYCTDDEALFGFQELGMVEGILPALESSHAVGYVIKNRK
QFQGQTVIVNLSGRGDKDVYTVARCMGVDI
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgacagagggaaggtatggggagtacggcggcacctacgtgccggagatgctggtcccg
gcgctgaaagacgtcgacgcaggctacaagagatacaggaacgatccggcgttccgggaa
gagctcgacgcttacatgaaggagttcgtgggcaggcccacacccctgacgaagtccagg
aacatgagccggaagtacggcttcactctctatttgaagagggaggaccaggccttcacc
ggcgctcataaaataaacaacaccatcgggcaggctctgctggcgaagcggatgggcaag
acccggctgatcgccgaaaccggggcaggccagcacggcgtcgctaccgcaacggcggcg
agggcgctgggcatgaagtgcacgatttacatgggtgaggtcgacatcgagcggcagaag
atgaacgtgttcaggatgcggctgctcggcgccgaagtagtatctgtcaagaacggcacc
cgcactttaaaagacgcgatcagcgaagccatgcggtcctgggtcacctgtctggacgac
acccactacctgttcggcaccgcatacggcccccacccataccctgaaatggtcaaggac
ttccagagtgtcattggcaaagaggccagagagcaggtgctgaatcaggaaggcaggctg
ccagatgcagtcgtcgcctgcgtgggcggaggcagcaacgcgatcgggatattttccggg
ttcatacccgatgaaagcgtccgcctgatcggcgtggaagccggcggctgcggtattgaa
agcggcaggcacgcggcccggttccagaccggcaccaaaggcgttctccacggctcatac
acttacgtgctgcaggacaggtacggacagatctcggacacccacagcgtttctgctggt
ttggactatgccgccgtaggccccgagcacgctttactgagggatctaaagagagcagaa
tacagctactgcaccgacgacgaggcactgttcggattccaggagctgggcatggtggaa
ggcatcctgcccgcgctggaatcctcgcatgcagtgggttacgtaatcaagaacaggaag
cagttccagggccagacggtcatcgtcaacctgtccggcagaggagacaaggacgtgtac
actgtagccaggtgcatgggggtcgacatctga

DBGET integrated database retrieval system