KEGG   Methanocella arvoryzae: RCIX799Help
Entry
RCIX799           CDS       T00526                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rci  Methanocella arvoryzae
Pathway
rci00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rci01100  Metabolic pathways
rci01110  Biosynthesis of secondary metabolites
rci01130  Biosynthesis of antibiotics
rci01230  Biosynthesis of amino acids
Module
rci_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rci00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RCIX799 (trpC)
Enzymes [BR:rci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     RCIX799 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth
Motif
Other DBs
NCBI-ProteinID: CAJ36168
UniProt: Q0W625
Position
2039366..2040133
Genome map
AA seq 255 aa AA seqDB search
MYIMVVSKLDFGEIMQACKASYKPFEGTVEMTRKPASLVDSIAAAKKDGRRPVIAEIKPA
SPTAGAIRTVGDPAEIAKEYAGAGACGVSVLTEPKYFGGSLANLQSAAGISVPVLRKDFL
FDLSQVKESYYYGADTLLLISSFFSADSLAAMIAECRRYGMEPLVEVHDRDDVERSASAG
ATLYAVNNRDRHTLKVDLRRTRDLAPAIDGTVVSASGVSTVDQLKFVLSYSDAALVGTAL
MRAERPGSALQNLIW
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
ttgtacataatggtggtgtctaaactggacttcggcgagatcatgcaggcctgcaaggca
tcctacaagccctttgagggcacggtagagatgaccaggaagcccgccagcctcgtcgac
agcatcgccgcggcgaagaaggacggcaggcggccggtgatcgcggagatcaagcccgcg
tcgcccacggcaggcgccatcaggacggtcggcgacccggcggagatcgcgaaagaatac
gccggtgccggggcctgcggtgtctctgtactgacagagcccaaatacttcggcggctcg
ctcgccaatctacagtctgcagccgggatcagcgtgcccgtgctgcggaaagactttctg
ttcgacctctcccaggtaaaagaatcgtattattatggtgccgacaccctgctgctgatc
tcgtccttcttctctgccgattccctcgccgccatgatcgccgaatgccggcggtacggc
atggagccgctggtcgaagtgcacgacagggacgacgtcgagcgctccgcatcggcggga
gccacgctgtatgcggtcaacaatcgcgacaggcacaccctgaaggtcgacctccggcgc
accagggatctggctcctgcgatagacggtactgtagtcagcgcgtccggcgtgtccacc
gtcgatcaactgaaatttgttctctcgtattccgacgctgcccttgtcggcaccgcgtta
atgagggctgaacgtccgggttcggctcttcagaacctgatctggtga

DBGET integrated database retrieval system