KEGG   Methanocella arvoryzae: RCIX879Help
Entry
RCIX879           CDS       T00526                                 

Gene name
tatC-1
Definition
putative sec-independent periplasmic protein translocase
Orthology
K03118  
sec-independent protein translocase protein TatC
Organism
rci  Methanocella arvoryzae
Pathway
Protein export
Bacterial secretion system
Module
Twin-arginine translocation (Tat) system
Brite
KEGG Orthology (KO) [BR:rci00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    RCIX879 (tatC-1)
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    RCIX879 (tatC-1)
Secretion system [BR:rci02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein [MD:M00336]
   RCIX879 (tatC-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1972340..1973065)
Genome map
AA seq 241 aa AA seqDB search
MAAESSLPPGDMEMSLSEHLRELRNRLIIVIAVTLLLMLAIFPFSAGLVDAVLAHAVPSY
VKITTYAPMEMFKARLTMCFIGAITVGFPLLVYEAFRFAAPGLYPHEKRFLYLVFPFSLL
LFVAGGLVAYFVTLPLFFSIVIGHGLEVAAPALSVGETFSIVTNFVAGLGLVFQVPLIIV
LAIKMGLVKRETLVKGRLGVYGLLFGVAMFFSPDPTLFSQLIVLAVLAILFEVSMVLTRF
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggcagccgaaagtagccttccgcccggggacatggagatgagcctgtcggagcacctc
agggagctgaggaaccggctgatcattgtgatcgccgtcactcttttgcttatgcttgct
atctttccgttctccgccggcctggtggacgcagttcttgcccatgctgtgccttcttac
gtgaagatcacgacttatgcgccgatggagatgtttaaggcgaggctgaccatgtgcttc
atcggggcgatcaccgtgggctttccgctgctggtgtacgaggcgttccggtttgcagcg
ccgggactgtacccgcatgagaagcgttttctgtacctggtgttcccgttctcgctcctg
ctcttcgtcgcgggaggcctcgtcgcatacttcgtgaccctgccgctgttcttcagcatc
gtcattgggcatgggctggaggtagccgcgcctgcgttgtccgtgggcgagacgttctcg
atcgtgaccaacttcgtggcaggcctgggcctcgtcttccaggtgccgctgatcatcgtg
ctggcgatcaagatgggcctggtgaagagagagacgctggtcaaaggccggctgggagtg
tacgggctgcttttcggcgtggccatgttcttctccccggacccgacgttgttctcccag
ctcattgtactggctgtgctggccatactgttcgaggtaagcatggtgctgacccgcttc
ctgtga

DBGET integrated database retrieval system