KEGG   Methanocella arvoryzae: RCIX879Help
Entry
RCIX879           CDS       T00526                                 

Gene name
tatC-1
Definition
putative sec-independent periplasmic protein translocase
Orthology
K03118  
sec-independent protein translocase protein TatC
Organism
rci  Methanocella arvoryzae
Pathway
Protein export
Bacterial secretion system
Module
Twin-arginine translocation (Tat) system
Class
Genetic Information Processing; Folding, sorting and degradation; Protein export [PATH:rci03060]
Environmental Information Processing; Membrane transport; Bacterial secretion system [PATH:rci03070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1972340..1973065)
Genome map
AA seq 241 aa AA seqDB search
MAAESSLPPGDMEMSLSEHLRELRNRLIIVIAVTLLLMLAIFPFSAGLVDAVLAHAVPSY
VKITTYAPMEMFKARLTMCFIGAITVGFPLLVYEAFRFAAPGLYPHEKRFLYLVFPFSLL
LFVAGGLVAYFVTLPLFFSIVIGHGLEVAAPALSVGETFSIVTNFVAGLGLVFQVPLIIV
LAIKMGLVKRETLVKGRLGVYGLLFGVAMFFSPDPTLFSQLIVLAVLAILFEVSMVLTRF
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggcagccgaaagtagccttccgcccggggacatggagatgagcctgtcggagcacctc
agggagctgaggaaccggctgatcattgtgatcgccgtcactcttttgcttatgcttgct
atctttccgttctccgccggcctggtggacgcagttcttgcccatgctgtgccttcttac
gtgaagatcacgacttatgcgccgatggagatgtttaaggcgaggctgaccatgtgcttc
atcggggcgatcaccgtgggctttccgctgctggtgtacgaggcgttccggtttgcagcg
ccgggactgtacccgcatgagaagcgttttctgtacctggtgttcccgttctcgctcctg
ctcttcgtcgcgggaggcctcgtcgcatacttcgtgaccctgccgctgttcttcagcatc
gtcattgggcatgggctggaggtagccgcgcctgcgttgtccgtgggcgagacgttctcg
atcgtgaccaacttcgtggcaggcctgggcctcgtcttccaggtgccgctgatcatcgtg
ctggcgatcaagatgggcctggtgaagagagagacgctggtcaaaggccggctgggagtg
tacgggctgcttttcggcgtggccatgttcttctccccggacccgacgttgttctcccag
ctcattgtactggctgtgctggccatactgttcgaggtaagcatggtgctgacccgcttc
ctgtga

DBGET integrated database retrieval system