KEGG   Methanocella arvoryzae: RCIX912Help
Entry
RCIX912           CDS       T00526                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase (porphobilinogen synthase)
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
rci  Methanocella arvoryzae
Pathway
rci00860  Porphyrin and chlorophyll metabolism
rci01100  Metabolic pathways
rci01110  Biosynthesis of secondary metabolites
rci01120  Microbial metabolism in diverse environments
Module
rci_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:rci00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RCIX912 (hemB)
Enzymes [BR:rci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     RCIX912 (hemB)
Exosome [BR:rci04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RCIX912 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: CAJ36259
UniProt: Q0W5T4
Position
complement(1948341..1949315)
Genome map
AA seq 324 aa AA seqDB search
MGYPVTRLRRLRQTKLIRDMVSETSLDVKDLICPIFVDESAEERKPIGSMPGIERLPLAG
LEAEADEIAKLGIPAVILFGIPEHKDQTGDAAYAAGNVIEQAIKAIKRRNRDLLVIADVC
LCEYTTHGHCGPIKNNTVDNDATLDIIARTAVNYARAGADVVAPSGMMDGMVHAIRSELD
FYGLKDTIIMSYAAKYASASYGPFREAASSGCQGFDRSTYQMDPANSDEAIREVALDLEE
GADIVMVKPALSYLDIIYRVKSEFRVPVAAYNVSGEYAMIKAAAANGWIDGEKVARETLL
SMRRAGADMIITYFAKEIAPTLGK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgggatacccggtaacaagactaaggcgtctaagacagactaagctcatcagggacatg
gtcagcgaaacctcgctcgacgtcaaagacctgatctgccccatattcgtggacgagagc
gctgaggaacgcaagccgataggctccatgcccggcatagagaggctgcctctcgccggc
ctcgaagcggaagcggacgagatcgcaaagctgggcataccagccgtcatcctgttcggc
ataccggagcacaaggatcagaccggcgacgccgcgtacgcagccggcaacgtgatcgag
caggccatcaaggcgatcaagcgccggaacagagaccttttagtcatcgcagacgtgtgc
ctgtgcgaatacaccacgcacggccactgcgggccgatcaaaaacaatacggtcgacaac
gacgccacgctggacattatcgccaggacggcggtcaactacgccagggccggcgcagac
gtggtcgccccctcgggcatgatggacggcatggtccacgccatcaggagcgagctggac
ttctacgggctgaaggataccatcatcatgtcctatgcagccaagtacgcctctgcatcc
tacggcccgttcagggaggccgcctcctcgggatgccagggcttcgaccggtcgacgtac
cagatggacccggcgaactctgacgaggcgatcagagaagtagccctcgaccttgaggag
ggcgccgacatcgtcatggtcaagcccgccctgtcctatttagacatcatctaccgggtc
aagtccgagttccgggtgccggtagcagcatataacgtgagcggggagtacgccatgatc
aaagcggcggccgccaacgggtggatagacggcgagaaggtcgcccgggagacgctgctc
tccatgcgccgggcgggagcggacatgatcatcacctacttcgcgaaagagatcgccccc
acgctggggaaataa

DBGET integrated database retrieval system