KEGG   Methanocella arvoryzae: RRC107Help
Entry
RRC107            CDS       T00526                                 

Gene name
porA-2
Definition
pyruvate:ferredoxin oxidoreductase, alpha subunit (EC:1.2.7.1)
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
rci  Methanocella arvoryzae
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RRC107 (porA-2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RRC107 (porA-2)
   00020 Citrate cycle (TCA cycle)
    RRC107 (porA-2)
   00620 Pyruvate metabolism
    RRC107 (porA-2)
   00640 Propanoate metabolism
    RRC107 (porA-2)
   00650 Butanoate metabolism
    RRC107 (porA-2)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    RRC107 (porA-2)
   00680 Methane metabolism
    RRC107 (porA-2)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    RRC107 (porA-2)
Enzymes [BR:rci01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     RRC107 (porA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(412336..413436)
Genome map
AA seq 366 aa AA seqDB search
MKKMATGNQAVAYAVKECDVEVVAAYPITPQTEVVETVANFVETGKMKAAYIRVESEHSA
LAACIGASATGARAFTATSSHGLLYMHEMIHWAAGARLPIVMANVNRSVGPAWNIWAEHT
DALSQRDTGWMQFYAATVQEVYDSVIMGYKLAESVYLPCMINLDGFILSHAIQPLDITET
GDFLPEINMPHAIDTENPMSYGNLTGPADYFKFRRMIKDDMDLAGRLMKEIEAEFAERFG
RKYSAVMEYKTDDAEVVIVGMGTIAREAEMAVDLLRKEGVKAGAVRVRQFRPFPDLSILE
GKRVVVLDRDYSPGAGGILAQEIRFRHDVKVFNVIAGIGGQDVTFKDLAAIVRKAKPEGE
VWLGVD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaagatggcaacgggcaaccaggcggttgcctacgcagtcaaggagtgcgacgtg
gaagtcgtcgcagcttacccaatcaccccgcagacggaagtggtcgagacagtggcgaac
ttcgtcgagaccggcaagatgaaggccgcctatatccgggtcgaaagcgagcactcggcg
cttgccgcctgcatcggtgcatccgccacaggcgccagggctttcacggctacctcgagc
catggcctgctctacatgcacgagatgatccactgggcggcgggcgcacgtctgcctata
gtcatggcaaatgtcaacaggtctgtcggcccggcctggaatatatgggctgagcacacg
gacgccctgtcccagagagacaccgggtggatgcagttctacgctgcgacggtgcaggaa
gtctacgactcggtgatcatgggctacaagctcgctgagtctgtgtacctgccctgcatg
atcaacctcgacgggtttatcctcagccacgcgatccagccgctggatattaccgaaaca
ggcgacttcctgcctgagattaacatgcctcacgcgatcgacactgaaaacccgatgtcg
tatggcaacctgaccggcccggcagactactttaagttccgccgcatgatcaaggacgat
atggatctggcgggcaggctaatgaaagagatcgaggcagagttcgcagagcggttcggg
cgcaaatactctgcggttatggagtacaaaacagacgatgccgaagtcgttattgtaggc
atgggcaccatcgcgagggaggctgaaatggccgtggacctgctgcgcaaggaaggcgtg
aaagcaggcgcggtcagagtcaggcagttcaggccgttcccggacctcagcattcttgag
ggcaagcgtgttgttgtgctggaccgcgattactccccgggcgccggtggtatcctcgca
caggaaatccggttcaggcacgacgtcaaggtcttcaacgtaatcgccggcatcggtggc
caggacgtcaccttcaaggatctcgccgccatcgtaaggaaggccaaacctgaaggcgaa
gtctggctgggggtggactaa

DBGET integrated database retrieval system