KEGG   Methanocella arvoryzae: RRC124Help
Entry
RRC124            CDS       T00526                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase complex E2,dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rci  Methanocella arvoryzae
Pathway
rci00010  Glycolysis / Gluconeogenesis
rci00020  Citrate cycle (TCA cycle)
rci00620  Pyruvate metabolism
rci01100  Metabolic pathways
rci01110  Biosynthesis of secondary metabolites
rci01120  Microbial metabolism in diverse environments
rci01130  Biosynthesis of antibiotics
rci01200  Carbon metabolism
Module
rci_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RRC124 (pdhC)
   00020 Citrate cycle (TCA cycle)
    RRC124 (pdhC)
   00620 Pyruvate metabolism
    RRC124 (pdhC)
Enzymes [BR:rci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RRC124 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3 RnfC_N NQRA ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: CAJ37890
UniProt: Q0W153
Position
401085..402371
Genome map
AA seq 428 aa AA seqDB search
MTYEFKLPDLGEGITSGEIKKWNVKKGDKVEEDDPIAEVETDKAVVELPAPVSGTVEDIK
FKEGDMVPVGSVIAVIREEGEETKAPPPPQEKAPSPVQEKAIEKATAEAKEPEVKPPAEA
VGRAPGKVPVLATPATRMLAKQLGVDIESIKGTGLGGRITDEDVKAASAKPAAKPAPAPA
PAPTPAPAAPPAGPAGLEERIPLRGIRRTISDNLMRSLQHTAQVTVFDDADVTKLSELRE
QVNGARKDGVKVSYLAFTVKAVSAALRNHPVLNASIDDEKGEIVLKKYYNIGLAIDTPRG
LMVAPVKDADRKSIVQISREIKELVELAESGKIGVEQLRGSTFTIANIGSIGGLFATPII
NPPESAILEMQQIRDMPRVCDGNVCVRKVMNLSLTIDHRIIDGAEGQRFLNEVKGYLEDP
AALLVNMP
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtacgagttcaagcttcccgatctgggcgagggcatcacttcgggagaaataaag
aagtggaacgtgaagaagggcgacaaagtagaggaagacgacccgatcgccgaggtcgag
acagataaggcagtcgtagagctgccagcacccgtttccggtacagtagaggatatcaag
tttaaggaaggtgatatggtcccggtcggcagcgtgatcgctgtcatccgggaagaaggc
gaagagactaaggcgccgccaccgccgcaggaaaaggcgccttctcctgtacaggagaag
gcgatcgagaaggctactgcagaggcgaaggagccggaagttaagccgcctgccgaagct
gtcggcagagcccccggaaaagtcccggtgctggccactccggcgacccgtatgctggca
aaacagctgggcgtagacatcgaatcaataaaaggcacgggccttggcggccgtattact
gacgaggatgtcaaagccgcatcagcaaagccagccgcaaagccagcgcctgctcctgct
cccgctcccactcctgcgccggccgctcctcccgccgggcctgccgggctggaagaacgg
ataccactgcggggcatcaggcggacgatttccgacaacctgatgcgctccctccagcat
actgcgcaggtgactgttttcgacgatgcagacgtgactaagctgagcgagctccgggag
caggtgaacggcgcccgtaaagacggagtcaaggtgagctaccttgctttcactgtgaaa
gccgtgtctgcagctctccggaatcatcctgtcctgaacgccagtattgacgacgagaaa
ggcgagatagtgctcaagaagtactacaatatcggcctggccatcgacactcccagaggc
ttgatggtagcacctgtgaaggatgccgatcgcaagagtatcgtgcaaatctccagggag
atcaaagagctcgtcgagctggcggagtcggggaagatcggcgttgagcagctacgggga
agtacattcactatcgccaacatcggcagtatcggggggctttttgccacgcctatcatc
aacccgccggaatctgctattcttgagatgcagcagataagggatatgccccgggtctgc
gacggcaatgtctgtgtgcgcaaggtgatgaacctgagcctgacgatcgaccaccgcatc
atcgacggcgccgaaggccagcgttttctgaacgaggtcaaaggctatctcgaagacccg
gctgcactactggtaaatatgccgtga

DBGET integrated database retrieval system