KEGG   Methanocella arvoryzae: RRC19Help
Entry
RRC19             CDS       T00526                                 

Gene name
hat
Definition
histone acetyltransferase (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
rci  Methanocella arvoryzae
Brite
Enzymes [BR:rci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     RRC19 (hat)
Transfer RNA biogenesis [BR:rci03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    RRC19 (hat)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(477329..478924)
Genome map
AA seq 531 aa AA seqDB search
MDEIQIACRELIDLILSGNVATQDELNKAKKNVSIAHRLSKLPRNSDILAAAATDAERDV
VLGLLQKRPIRTISGVAVVAVMTSPEKCPHGKCVPCPGGVDSVFNSPQSYTGTEPAALRA
KQEDYDPYRQVTVRLSQLKQIGHDLDKCELIIMGGTMTARSLDYQEWFVRRCLEAMNDFG
GEPHPTYFIEEAQKANETASIRNVAMTFETRPDWCREIHVDRMLNMGGTKVELGVQSTYD
FVLKRIERGHSVADSVEANRILRDSGFKIGFHMMPGLPGSDFERDLRMFKELFEDSRFCP
DYLKIYPTLVTEGTKLHDMWERGEYKPLSSDDAAVLIAQIKASLPPWVRLQRIQRDIPIK
HIVDGVVKSNVRQLSGDLLKDSHLKCRCIRCREIGHKVLQGSKPDPAAVRLHEHKMAVCG
GTEHFLSFDDESIDALVGFLRLRFPHRPHRPELADAAIVRELHVYGRMVPIGEKDDAWQH
QGYGKKLLARAEELATEAGFKKLAIISGIGARQYYQKLGYRHDGPYMSKML
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaatccagattgcctgccgagagttgattgatcttattctatccggcaacgtg
gccacccaggatgagctaaataaggcgaagaagaacgtcagcatagcccaccggctctcc
aagctgccccggaactccgacattctggcagcagccgctaccgacgccgagcgtgacgtt
gtactcgggctcctccagaaacgccctatccgcacaatttccggcgtagccgtcgtggct
gtcatgacctcacccgagaagtgcccccacggcaagtgcgtgccctgcccgggcggcgtc
gattctgtctttaattcccctcagagctataccgggacagagccagccgcattgagggcg
aagcaggaggactacgatccctacaggcaggtcacagtccgtttatctcaactcaagcag
atcggccatgatcttgataaatgcgagctcatcatcatgggcggcacgatgactgcccgc
agtctcgattatcaggaatggttcgtacgccggtgcctcgaagcgatgaacgacttcgga
ggcgagccgcatcccacttacttcatcgaagaagcacagaaggccaacgaaacagcaagc
atccgcaacgtggctatgactttcgaaacccgccccgactggtgccgggaaatccacgtc
gaccggatgctgaacatgggcggcaccaaggtcgaattaggggtgcagagcacctacgac
ttcgtcctgaagaggattgagcggggccactcggtcgcggattcggtcgaagcgaaccgt
atcctccgggactcaggcttcaagatcggcttccacatgatgcccggccttcccggctcg
gacttcgagcgggatctcaggatgttcaaagagctgttcgaggacagccggttctgtccc
gactacctgaaaatctatccgaccctggtgaccgaggggacaaaactccatgacatgtgg
gagcggggcgaatataaacccctgtcaagcgacgacgccgcagtactgatcgctcagatc
aaggcatcgctgccgccgtgggtgaggctgcagcgtatccagcgggatatcccgatcaag
catatcgtagacggagtagtcaagagcaatgtccgccagctttcgggagatctgcttaag
gactcacaccttaaatgccgctgtatccggtgccgggagatcgggcacaaagtgctccag
ggctcgaaaccagatccggcagctgttcggctccacgagcacaaaatggccgtctgcggc
ggcaccgaacacttcctgtccttcgacgacgagagcatcgacgctctcgtgggattcctc
cgcctcaggttccctcacaggccccaccggccggaactcgccgacgcagccatcgtccgg
gaactgcacgtctacgggcggatggtgcctatcggagaaaaggacgatgcatggcaacac
cagggctatggtaaaaagctccttgcaagggctgaagagctcgccaccgaagccggcttt
aagaaactggccatcatcagcggcatcggagccaggcagtattaccagaaacttggatac
aggcatgatggaccttatatgtctaagatgctgtaa

DBGET integrated database retrieval system