KEGG   Methanocella arvoryzae: RRC211Help
Entry
RRC211            CDS       T00526                                 

Gene name
acs-2
Definition
(RefSeq) putative acetyl-CoA synthetase (AMP-forming) (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rci  Methanocella arvoryzae
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:rci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RRC211 (acs-2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RRC211 (acs-2)
   00620 Pyruvate metabolism
    RRC211 (acs-2)
   00640 Propanoate metabolism
    RRC211 (acs-2)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    RRC211 (acs-2)
   00680 Methane metabolism
    RRC211 (acs-2)
Enzymes [BR:rci01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RRC211 (acs-2)
Lipid biosynthesis proteins [BR:rci01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RRC211 (acs-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
326173..327861
Genome map
AA seq 562 aa AA seqDB search
MRYRGKKMSLLHKFLDRTEFNSYEDFRQNLKIKVPENFNFAYDVVDVYARESPDKIALVW
CDDFGGEKIISFSEMKLMSDRAANLFKSIGIRKGDAVMLALKGRYEWWPIMLALHRIGAI
AIPATHMLTTKDIVYRLKLADIKMMIAAEDKYLVPAVDAAQKECPDILKYKVVVNGNHPG
WIDFDTEVEKAGDHFERPTGEEATKNEDISILYFTSGTTGMPKMVVHDFAYPLGHILTAK
YWQNVMDNGLHYTVADTGWAKAVWGKIYGQWIAGTAVFAYDYEQFNPVNLLEMNQKYKVT
TFCAPPTIYRFLINEDMSKYDFSHLKYCVVAGEPLNPEVYNKWLKLTGIRLMEGYGQTEM
TVSIATYPWMNPKPGSMGKPSPGYNIVLLNALGKPCEVGEEGEIVIDTSKGMPVGLFKGY
YRDEARTKSIWNNGLYYTGDMAWMDEDGYMWFVGRSDDVIKSSGYRIGPFEVESALIQHP
AVVECAITAVPDEIRGQVVKATVVLKKGYDPCDALKKELQDHVKKVTAPYKYPRIVEFVP
ALPKTISGKIRRVEIRDKDKAA
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
gtgaggtatagaggtaaaaaaatgtcattgttacacaagttcctggacaggaccgaattc
aattcttacgaagatttcagacagaacctcaagatcaaagtccctgaaaacttcaacttc
gcctatgatgtcgtagacgtctacgccagagagagccccgacaagatcgccctcgtctgg
tgcgacgacttcggcggagagaagatcatcagcttctccgaaatgaagctgatgagcgac
agggcagccaatctgttcaagagcatcgggatcagaaagggcgacgcggtcatgttagcc
ctcaagggcaggtatgaatggtggcccatcatgctcgcgctccacaggatcggtgcgatc
gccatccctgccacccacatgctcacgactaaagatatcgtgtacaggctaaagctcgcc
gatatcaagatgatgatagcggcagaggacaaatacctcgttccggcagtcgacgctgcc
cagaaagagtgcccggacatccttaagtataaagtggttgtgaacggcaatcatcccggc
tggatcgactttgatacagaggtagagaaggctggtgatcacttcgagcggccgaccggc
gaagaggccacgaagaatgaggacatctctatcctgtacttcacctcgggaactaccggc
atgcccaagatggtggtgcacgacttcgcctacccgctggggcatatcctcacggcaaag
tactggcagaacgtcatggacaacggcctccactacacggtggcagataccgggtgggca
aaggcagtctggggcaaaatatacggccagtggatagcaggcacggccgtattcgcctac
gactacgagcagttcaaccctgtgaacctgctggagatgaaccagaaatacaaggtcacc
actttctgtgccccgcccacaatctacaggttcctcatcaacgaggacatgtcgaagtac
gacttctcccacctcaagtactgtgtggtagcaggcgagcccctcaacccggaggtatat
aacaagtggcttaagctcaccggcatccggctgatggaaggctacggacagactgaaatg
acggtctcgatcgccacctacccgtggatgaatcccaagcccggttccatgggcaagccc
tccccgggctacaatatcgtcctcctcaacgcgctgggtaaaccatgcgaagtcggagaa
gaaggcgagatcgtcatcgataccagcaaagggatgccagtgggcctgttcaaaggctac
taccgcgacgaggcgcggacgaagtccatctggaacaatggcctctattatacaggcgac
atggcctggatggatgaagacggctacatgtggttcgtcggcaggtctgacgacgtcatc
aagagctccggctacagaatcggccccttcgaagtcgaaagtgccctaatccagcacccg
gcggtcgtggagtgcgcgatcacggcagtgcccgacgaaatcaggggacaggtcgtcaag
gctacagtcgtccttaaaaagggctacgacccatgtgacgccctgaagaaagagctccag
gaccacgtgaagaaggtcacagcgccttacaagtaccccaggatcgtcgagttcgtcccc
gccctgcccaagactatcagcggcaaaatccgcagggtggagatcagggacaaggataag
gcagcttaa

DBGET integrated database retrieval system