KEGG   Methanocella arvoryzae: RRC230Help
Entry
RRC230            CDS       T00526                                 

Gene name
aor-2
Definition
putative tungsten-containing aldehyde:ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
rci  Methanocella arvoryzae
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RRC230 (aor-2)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RRC230 (aor-2)
Enzymes [BR:rci01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     RRC230 (aor-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(300422..302326)
Genome map
AA seq 634 aa AA seqDB search
MPGGYTGKLLRVDLTRGRFTIEKPDEATLRDYIGGEGLGIKYLYDEVPAACDPLGPDNRL
IFMTGPVTGSLAPTSGRHCVTTKSPLTGCQVTSHAGGYWGTQLKLAGYDGIIVQGQSEAP
VYLFIDDGEPQLYDAGNLWGRDVFQTDLLVKEELYDKKVSVTAIGPAGENLVRYASIQND
HQRSAARGGTGAVMGSKKLKAIAVRGTQSFYAADPDAYKASMDELLDSTYNNVISGSLLP
KNGVTGIMDMVNKHGVLPTRNHQSGTFEHAHDISGQKMSGTMLTRTRGCYCCNIYCTRLI
NVPYGPYHGLRGKGPDYDATVAFGSQCGNGNLEAAAQANLWCDQYGLDAVTTGETIAWAM
ELYERGIIDRHDTRGLDLRFGNHEAMVAMVPKIATRMEFGAVLADGLAEAAKKIGKGSEQ
YVMAVKNMDLPGFEARGSKAMGLQYAVDNRGGDNLRPFGVMTECFGFRSKELNMPEQYDP
LSEANKTQWLIPAQNYSVAVNSLICCMFTIIGYSVEPSQYARQLSAITGFSYDTDRLLLA
GERIWNLQRAFNVREGFTRKDDRLPDRLTTEPAPSGPAAGSTVHLDPMLDAYYEARGWDR
SGIPTMEKLRSLGLEHVSRDLNRAREEAGAPATA
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcggatatactggaaagctcctgagagtagaccttacccggggcaggtttact
atcgaaaagcccgacgaagctaccctcagggattacatcgggggcgaaggcctcggaatc
aagtacctgtacgacgaagtcccggcagcatgcgatccgctggggcccgataaccggctc
atattcatgactggcccggtaaccgggtcactggcgccgacttccggcagacactgcgtt
accacaaaatcgccgctaactggctgtcaggtgacttcgcacgccggcggctactgggga
acccagctaaagctggccggctacgacgggatcatcgtccagggccagagcgaggctccc
gtttatctgttcatcgatgacggggagcctcagctatacgatgctggcaacctctggggc
agagatgtctttcagactgatctgctcgtcaaggaagagctgtacgataaaaaggtcagt
gtcaccgctatcggtcctgccggcgaaaacctggtcaggtatgccagcatccagaatgat
catcagcgatcggcggccaggggcgggacaggcgccgtgatgggttcgaaaaaactcaaa
gccatcgctgtaagaggtacccagagcttttatgccgcagatcccgacgcatataaagcg
tccatggatgagttgctggatagcacatacaacaacgttatctccggcagcctcctgccg
aagaacggcgtcactggcatcatggatatggtgaacaagcatggggtgcttccaacacga
aaccatcagtcgggcaccttcgagcatgcgcatgacatatccggccaaaaaatgtccggg
acgatgctgaccagaacccggggatgctactgctgtaatatctattgcacccggctgatc
aacgttccttacgggccatatcacggtttgagggggaaaggccctgactacgatgccaca
gtggcttttggttcgcagtgcggcaacgggaacctggaggctgccgcccaggcgaacctc
tggtgcgatcagtacggcctcgacgctgttacgaccggggaaacgatcgcatgggctatg
gagctttacgagcggggcatcatcgatcgccatgatacgagagggcttgatctcaggttt
ggtaaccatgaagctatggtcgccatggtgcccaagatcgccacccgcatggagttcggc
gcagtgctggcagacggcctggccgaagccgccaaaaagatcggcaaaggctcggaacag
tacgtcatggcagtaaaaaatatggacctgccgggcttcgaggcccggggtagcaaggcg
atgggcctgcagtatgccgtcgacaaccggggcggcgacaacctgaggcctttcggggta
atgaccgagtgctttggcttccggtctaaagagctgaatatgccggaacagtatgacccg
ctttccgaggcgaataaaacgcagtggctgatccctgcccagaactattccgtcgcagtc
aactcgctgatatgctgtatgtttacgattatcgggtactcagtagagcccagtcagtac
gcacgccagctctcggcgatcacaggctttagctacgacacggaccgcctgttgctcgct
ggcgagaggatatggaatctacaacgggctttcaacgtccgggaaggctttaccagaaag
gatgaccggctgccggaccggctcaccaccgagcctgcgccatccgggcctgcagcagga
agcaccgtccatctcgatcctatgctggacgcctactacgaggcgagaggctgggacaga
agcggaatccccaccatggaaaagctccgatcgctcgggctggagcacgtctcaagggat
ctcaaccgggccagggaggaagcaggagcgccggcaaccgcatga

DBGET integrated database retrieval system