KEGG   Methanocella arvoryzae: RRC45Help
Entry
RRC45             CDS       T00526                                 

Gene name
pfkB-3
Definition
ATP-dependent phosphofructokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rci  Methanocella arvoryzae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rci00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RRC45 (pfkB-3)
Enzymes [BR:rci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     RRC45 (pfkB-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
456816..457718
Genome map
AA seq 300 aa AA seqDB search
MVDVIMVGTVALDTVRTPFGLAEETLGGSAVYASVAASLFASVGLVGVVGKDFPQKHVDF
LRAKGVDMAGLETLDGETFRWKGYYEYDMNQAHTQDTQLNVLSRFDPVLPPEYRDCKYVF
LANTDPEIQMRVYEQINKPKLVMMDTMNFWIESKKEALSRMIEKVDVMLTNDAEARQFFD
TPSLVKAGKAFLEMGPKAVIIKKGEHGALMFTEDQCFSAPAYPLEKLTDPTGAGDSFAGG
FIGWLARTDDISPRNMRKAVIFGSTIASYNAEAFSLDKLKTISRDDVFNRYMRFQDIASF
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggtcgatgtcatcatggtcggcactgtggcgctggacacagtgcgcacacctttcggc
ctcgccgaggagacgctgggcggctctgccgtctacgcctccgtcgccgcgagcctgttc
gccagcgtgggcctggtaggcgtagtgggcaaagacttcccacagaaacacgtagacttt
ttaagagcaaaaggcgtcgatatggcgggcctcgaaactctggacggggaaacgttcagg
tggaagggctactacgagtacgacatgaatcaggcacatacccaggacacccagctgaac
gtgctgtccaggttcgaccccgtgctacccccggaataccgggactgcaagtacgtcttc
ctggctaacacggacccggagatccagatgcgggtctacgagcagatcaacaagccgaag
ctggtcatgatggacaccatgaacttctggatcgagagcaagaaagaagcgctgtccagg
atgatcgagaaggtcgacgtcatgctcaccaacgacgccgaagcccggcagttcttcgac
acgcccagcctggtcaaagcgggcaaagcgttcctcgagatggggccgaaagccgtcatc
atcaagaaaggcgagcacggcgcactcatgttcaccgaagaccagtgcttcagcgccccc
gcctacccgctggaaaagctgaccgacccgaccggcgctggcgactccttcgcgggcggc
ttcatcggctggctggccaggaccgacgacatctcgccccggaatatgagaaaggcagtc
atctttggcagcacgattgcctcgtacaatgccgaagcgttcagtcttgacaagctgaag
acgatatcccgcgatgacgtcttcaacaggtacatgagattccaggacattgcctcgttt
taa

DBGET integrated database retrieval system