KEGG   Methanocella arvoryzae: RRC46Help
Entry
RRC46             CDS       T00526                                 

Gene name
ahcY
Definition
S-adenosyl-L-homocysteine hydrolase (EC:3.3.1.1)
Orthology
K01251  
adenosylhomocysteinase [EC:3.3.1.1]
Organism
rci  Methanocella arvoryzae
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rci00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    RRC46 (ahcY)
Enzymes [BR:rci01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.1  Thioether and trialkylsulfonium hydrolases
    3.3.1.1  adenosylhomocysteinase
     RRC46 (ahcY)
Protein phosphatases and associated proteins [BR:rci01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     RRC46 (ahcY)
Exosome [BR:rci04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RRC46 (ahcY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
455536..456795
Genome map
AA seq 419 aa AA seqDB search
MAKDYAVKDIGLAQQGLDRIEWARRHMPVLNLIKAEFEKNKPLKGVNVIACLHVTVETAN
LIETLLAGGANVALTASNPLSTQDDVAAALAKKGVKVYAIRGEDEKTYYKHIEAALKIKP
NVTLDDGADVIATVHSKHKEYLKDIYGGCEETTTGVIRLRAMAADKALKYPVIAVNDAET
KMMFDNRYGTGQSTLHGILNATNILLAGKTVVVVGYGWCGRGVAARAKGMGANVVVVEIQ
PRKALEAAMDGFWVMDMTEAAKVGDLFITVTGDINVIRKEHFQLMKDQAIVCNSGHFNVE
LDLPSLKKMAKKVSTVKTDVEEYLLKDGRRIYVLGEGRLVNLACAFGHPPEVMDMSFANQ
ALSVKYIVENHKKLKKDVYKVPEDIDNRVAKLKLESMGIKLEQLTKEQENYLSSWNMGT
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggattatgcagtaaaagacattggccttgcacagcaaggcctggacaggatc
gaatgggcacgcaggcacatgccggtgcttaacctgatcaaggcagagttcgagaagaac
aagcccctgaagggcgtcaacgtgatcgcctgcctgcacgtgaccgtggagacagccaac
ctgatcgagaccctgctcgcaggcggagctaatgtggcgctcaccgcatccaatccgctc
tcgacccaggacgacgtggcggcagcgctcgcgaagaagggcgtcaaggtctacgctatc
cgcggcgaggacgaaaagacgtactacaagcacattgaggcagctctcaagatcaagccc
aacgtgacgctggacgacggcgcagacgtgattgccacagtccacagcaagcacaaggaa
tacctgaaggatatttacggcggctgcgaagagaccaccaccggcgtcatcaggctcaga
gccatggcagcggacaaggccctcaagtaccccgtgatagctgtcaacgacgcagagacc
aagatgatgttcgacaaccggtacggcaccggccagagcaccctgcacggcatcctgaac
gctaccaacatcctgctcgccggcaagactgttgtcgtagtcggctacggctggtgcggc
agaggcgtcgcagcccgggccaagggcatgggcgccaacgtagtcgtcgtagaaatccag
ccgcgcaaggcgctggaagcagccatggacggcttctgggtcatggacatgactgaggca
gcaaaggtcggcgacctgttcatcacggtcaccggcgacatcaacgtcatccgcaaggag
cacttccagctcatgaaggaccaggcgatcgtttgcaactccggccacttcaacgtagag
ctggatctgccttccctgaagaagatggcgaagaaggtctccacggtcaagaccgacgtc
gaggaatacctgctcaaggacggccgcaggatctacgtactgggcgaaggccgcctggta
aacctggcctgcgctttcggccacccgcccgaagtcatggacatgagcttcgccaaccag
gccctctcggtcaagtacatcgtcgagaaccacaagaagctaaagaaggacgtctacaag
gtgcccgaagacatcgacaaccgggtcgcaaagctcaagctggagtcgatgggcatcaag
ctggaacagctgaccaaggagcaggagaactacctgagctcctggaacatggggacataa

DBGET integrated database retrieval system