KEGG   Methanocella arvoryzae: RRC46Help
Entry
RRC46             CDS       T00526                                 

Gene name
ahcY
Definition
S-adenosyl-L-homocysteine hydrolase (EC:3.3.1.1)
Orthology
K01251  
adenosylhomocysteinase [EC:3.3.1.1]
Organism
rci  Methanocella arvoryzae
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:rci00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
455536..456795
Genome map
AA seq 419 aa AA seqDB search
MAKDYAVKDIGLAQQGLDRIEWARRHMPVLNLIKAEFEKNKPLKGVNVIACLHVTVETAN
LIETLLAGGANVALTASNPLSTQDDVAAALAKKGVKVYAIRGEDEKTYYKHIEAALKIKP
NVTLDDGADVIATVHSKHKEYLKDIYGGCEETTTGVIRLRAMAADKALKYPVIAVNDAET
KMMFDNRYGTGQSTLHGILNATNILLAGKTVVVVGYGWCGRGVAARAKGMGANVVVVEIQ
PRKALEAAMDGFWVMDMTEAAKVGDLFITVTGDINVIRKEHFQLMKDQAIVCNSGHFNVE
LDLPSLKKMAKKVSTVKTDVEEYLLKDGRRIYVLGEGRLVNLACAFGHPPEVMDMSFANQ
ALSVKYIVENHKKLKKDVYKVPEDIDNRVAKLKLESMGIKLEQLTKEQENYLSSWNMGT
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggattatgcagtaaaagacattggccttgcacagcaaggcctggacaggatc
gaatgggcacgcaggcacatgccggtgcttaacctgatcaaggcagagttcgagaagaac
aagcccctgaagggcgtcaacgtgatcgcctgcctgcacgtgaccgtggagacagccaac
ctgatcgagaccctgctcgcaggcggagctaatgtggcgctcaccgcatccaatccgctc
tcgacccaggacgacgtggcggcagcgctcgcgaagaagggcgtcaaggtctacgctatc
cgcggcgaggacgaaaagacgtactacaagcacattgaggcagctctcaagatcaagccc
aacgtgacgctggacgacggcgcagacgtgattgccacagtccacagcaagcacaaggaa
tacctgaaggatatttacggcggctgcgaagagaccaccaccggcgtcatcaggctcaga
gccatggcagcggacaaggccctcaagtaccccgtgatagctgtcaacgacgcagagacc
aagatgatgttcgacaaccggtacggcaccggccagagcaccctgcacggcatcctgaac
gctaccaacatcctgctcgccggcaagactgttgtcgtagtcggctacggctggtgcggc
agaggcgtcgcagcccgggccaagggcatgggcgccaacgtagtcgtcgtagaaatccag
ccgcgcaaggcgctggaagcagccatggacggcttctgggtcatggacatgactgaggca
gcaaaggtcggcgacctgttcatcacggtcaccggcgacatcaacgtcatccgcaaggag
cacttccagctcatgaaggaccaggcgatcgtttgcaactccggccacttcaacgtagag
ctggatctgccttccctgaagaagatggcgaagaaggtctccacggtcaagaccgacgtc
gaggaatacctgctcaaggacggccgcaggatctacgtactgggcgaaggccgcctggta
aacctggcctgcgctttcggccacccgcccgaagtcatggacatgagcttcgccaaccag
gccctctcggtcaagtacatcgtcgagaaccacaagaagctaaagaaggacgtctacaag
gtgcccgaagacatcgacaaccgggtcgcaaagctcaagctggagtcgatgggcatcaag
ctggaacagctgaccaaggagcaggagaactacctgagctcctggaacatggggacataa

DBGET integrated database retrieval system