KEGG   Methanocella arvoryzae: RRC499Help
Entry
RRC499            CDS       T00526                                 

Gene name
pfkA
Definition
ATP-dependent 6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rci  Methanocella arvoryzae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Formaldehyde assimilation, ribulose monophosphate pathway
Class
Metabolism; Overview; Carbon metabolism [PATH:rci01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rci01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rci00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:rci00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rci00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rci00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:rci00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(81128..82090)
Genome map
AA seq 320 aa AA seqDB search
MRTIGVVTSGGDAPGMNAAIRAIVRVAQAHGIAVIGFERGWEGLIYDNVMSLTPRSVSGI
IQQGGTILRTSRNKEFMTDEGMQKASVTLANNKVDGLIVIGGDGSFRAAHEFSKKTDTRI
AGIPATIDNDVYGTDETIGFDTAVNTGVTEIDKIRDTATSLDRVFIVEVMGRTRGFLAAM
IGLTVGAEIILVPEVKFQPEEVCDTILKNSAAGKKSGIIVAAEGIGDTHALAKEIQEHTR
IETRLSVLGYAQRGGHPTARSRFLASVFGKAAVEFLADGKENLIAALQHGKVTGISFDES
CCKSKELDLRLLKLARELSK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgaggaccatcggcgtcgtaaccagcggaggggatgcacccggcatgaatgcggctatt
cgggcaatcgtccgcgtagcccaggcacatggcatagctgtgattggtttcgagcggggc
tgggaaggcctgatctacgataacgtaatgtcgcttacaccccggtccgtaagcggtatt
attcagcagggcggcacgattctgaggacgtccaggaataaggagttcatgacggacgaa
ggcatgcaaaaagccagtgttactcttgccaacaacaaggtcgacgggctgatcgtcatc
ggcggagacggctctttccgggcggcgcacgagttcagcaaaaaaaccgataccagaatt
gccggcatccccgcgaccatcgataacgatgtctacgggaccgacgagacaatcggcttc
gatacggccgtcaacaccggtgtaacagagatcgacaagatcagggatacggcaacatcg
ctggacagagtcttcatcgtcgaagtcatgggccggaccagaggcttcctcgccgcgatg
ataggcctgaccgtaggcgcagagatcatcctggtgccggaggtcaagttccaacctgaa
gaggtctgcgacacgatcctaaaaaatagcgctgccgggaaaaagtcaggcatcatcgta
gctgcggaaggcatcggtgatacccatgccctggcaaaggagatacaggagcataccaga
atcgaaacccggctcagcgtcctgggatatgcccagagaggcggacacccgaccgcccgg
agccgattcctggccagcgtcttcgggaaagcggctgtagaattcctggcggacggaaag
gaaaatctgatcgcagctctgcagcatggaaaagtcaccggcatcagctttgacgagtcc
tgctgtaagtcgaaagagctggacctcaggctgctgaagctggcccgggagctgtcgaaa
tag

DBGET integrated database retrieval system