KEGG   Methanocella arvoryzae: RRC499Help
Entry
RRC499            CDS       T00526                                 

Gene name
pfkA
Definition
ATP-dependent 6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rci  Methanocella arvoryzae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:rci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RRC499 (pfkA)
   01230 Biosynthesis of amino acids
    RRC499 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RRC499 (pfkA)
   00030 Pentose phosphate pathway
    RRC499 (pfkA)
   00051 Fructose and mannose metabolism
    RRC499 (pfkA)
   00052 Galactose metabolism
    RRC499 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    RRC499 (pfkA)
Enzymes [BR:rci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RRC499 (pfkA)
Protein phosphatases and associated proteins [BR:rci01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     RRC499 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(81128..82090)
Genome map
AA seq 320 aa AA seqDB search
MRTIGVVTSGGDAPGMNAAIRAIVRVAQAHGIAVIGFERGWEGLIYDNVMSLTPRSVSGI
IQQGGTILRTSRNKEFMTDEGMQKASVTLANNKVDGLIVIGGDGSFRAAHEFSKKTDTRI
AGIPATIDNDVYGTDETIGFDTAVNTGVTEIDKIRDTATSLDRVFIVEVMGRTRGFLAAM
IGLTVGAEIILVPEVKFQPEEVCDTILKNSAAGKKSGIIVAAEGIGDTHALAKEIQEHTR
IETRLSVLGYAQRGGHPTARSRFLASVFGKAAVEFLADGKENLIAALQHGKVTGISFDES
CCKSKELDLRLLKLARELSK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgaggaccatcggcgtcgtaaccagcggaggggatgcacccggcatgaatgcggctatt
cgggcaatcgtccgcgtagcccaggcacatggcatagctgtgattggtttcgagcggggc
tgggaaggcctgatctacgataacgtaatgtcgcttacaccccggtccgtaagcggtatt
attcagcagggcggcacgattctgaggacgtccaggaataaggagttcatgacggacgaa
ggcatgcaaaaagccagtgttactcttgccaacaacaaggtcgacgggctgatcgtcatc
ggcggagacggctctttccgggcggcgcacgagttcagcaaaaaaaccgataccagaatt
gccggcatccccgcgaccatcgataacgatgtctacgggaccgacgagacaatcggcttc
gatacggccgtcaacaccggtgtaacagagatcgacaagatcagggatacggcaacatcg
ctggacagagtcttcatcgtcgaagtcatgggccggaccagaggcttcctcgccgcgatg
ataggcctgaccgtaggcgcagagatcatcctggtgccggaggtcaagttccaacctgaa
gaggtctgcgacacgatcctaaaaaatagcgctgccgggaaaaagtcaggcatcatcgta
gctgcggaaggcatcggtgatacccatgccctggcaaaggagatacaggagcataccaga
atcgaaacccggctcagcgtcctgggatatgcccagagaggcggacacccgaccgcccgg
agccgattcctggccagcgtcttcgggaaagcggctgtagaattcctggcggacggaaag
gaaaatctgatcgcagctctgcagcatggaaaagtcaccggcatcagctttgacgagtcc
tgctgtaagtcgaaagagctggacctcaggctgctgaagctggcccgggagctgtcgaaa
tag

DBGET integrated database retrieval system