KEGG   Rickettsia canadensis McKiel: A1E_00180Help
Entry
A1E_00180         CDS       T00603                                 

Definition
O-sialoglycoprotein endopeptidase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rcm  Rickettsia canadensis McKiel
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rcm00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    A1E_00180
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    A1E_00180
Enzymes [BR:rcm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     A1E_00180
Lipid biosynthesis proteins [BR:rcm01004]
 Desaturase
  First
   A1E_00180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(41107..42300)
Genome map
AA seq 397 aa AA seqDB search
MLSKLNKPALFSLIFYPIFIISLIVKYLFDYGIGLAEVIFIVASYYINNITVGIGLHRLW
SHNSYKINKYAEFILVMLSAGTLQGPALSWASNHYKHHAFTDKDQDPHTPLKFDNKFLGF
MWSHIGWMLVGNGSYKSIDRITWTKHGKNNLLKWQLKYYWQIAAFMNIVVPLFIGYLVGG
TMQSAYAGFLFMGLGRFLQQQATFCVNSLCHFIGSKKYYKGTAGDIWWMSLFLLGENWHN
YHHAFPSDYRNGAKWYHFDVHKWIIFLMSKVGLASELERTTKVRIQAKMQETLSYLSEKQ
KQKLSLMQTKIDQLLENLCLKIKELEESSITIKAQFKKSFVEIQESLKNLAEQISSATQI
TEKSSEKLLKIVNKKIIDAEQSIYKLYNQLNTFKVSN
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtaaactaaataagcctgctttattttctttaatattttatcctatttttatt
atatctcttatagttaaatatttgtttgattatggaataggattagctgaagttattttt
atagttgctagctattatattaataatattactgttgggatcggtttacataggctatgg
tctcataattcttataaaataaataaatatgccgagtttattttagttatgctgtctgca
ggaacattacaaggaccggctttatcttgggcatcgaatcattataaacatcatgctttt
acagataaagatcaagacccgcatactcctttaaaatttgacaataaatttttaggtttt
atgtggtctcatataggatggatgttggttggaaacggtagctataaatctattgatcgc
attacttggactaagcacgggaagaacaatttattaaaatggcagctaaaatattattgg
caaatagcagcttttatgaatattgtcgtacctttatttatcggttatttagtcggcggt
actatgcaatcagcatatgcaggatttttatttatgggactcggtagattcctgcaacaa
caagcaacattctgcgtcaattctttatgccactttatcggtagtaaaaaatattataaa
ggcactgccggagatatttggtggatgtcattattcttactcggtgaaaattggcacaat
taccatcatgcttttccttcagattatcgtaacggtgcaaaatggtatcattttgacgtt
cacaaatggataatatttttaatgagtaaagtcggtttagcttcagaactcgaacgtact
acaaaagtacggatacaggcaaaaatgcaagaaactttaagttatcttagtgaaaaacaa
aagcaaaaattgagcttaatgcaaactaaaatagatcagcttctagaaaatttatgctta
aaaattaaagagcttgaagaatcatctattacaattaaagcacaatttaaaaaatctttt
gtagaaatacaagaatcgcttaaaaatttagcggagcaaataagttctgcaacacaaata
acagaaaaatcttcagaaaaattactaaaaatagttaataaaaaaattattgatgctgaa
caatctatttataagctgtataatcaattaaataccttcaaggtatctaattaa

DBGET integrated database retrieval system