KEGG   Rickettsia canadensis McKiel: A1E_00180Help
Entry
A1E_00180         CDS       T00603                                 

Definition
O-sialoglycoprotein endopeptidase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rcm  Rickettsia canadensis McKiel
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:rcm01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:rcm01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(41107..42300)
Genome map
AA seq 397 aa AA seqDB search
MLSKLNKPALFSLIFYPIFIISLIVKYLFDYGIGLAEVIFIVASYYINNITVGIGLHRLW
SHNSYKINKYAEFILVMLSAGTLQGPALSWASNHYKHHAFTDKDQDPHTPLKFDNKFLGF
MWSHIGWMLVGNGSYKSIDRITWTKHGKNNLLKWQLKYYWQIAAFMNIVVPLFIGYLVGG
TMQSAYAGFLFMGLGRFLQQQATFCVNSLCHFIGSKKYYKGTAGDIWWMSLFLLGENWHN
YHHAFPSDYRNGAKWYHFDVHKWIIFLMSKVGLASELERTTKVRIQAKMQETLSYLSEKQ
KQKLSLMQTKIDQLLENLCLKIKELEESSITIKAQFKKSFVEIQESLKNLAEQISSATQI
TEKSSEKLLKIVNKKIIDAEQSIYKLYNQLNTFKVSN
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtaaactaaataagcctgctttattttctttaatattttatcctatttttatt
atatctcttatagttaaatatttgtttgattatggaataggattagctgaagttattttt
atagttgctagctattatattaataatattactgttgggatcggtttacataggctatgg
tctcataattcttataaaataaataaatatgccgagtttattttagttatgctgtctgca
ggaacattacaaggaccggctttatcttgggcatcgaatcattataaacatcatgctttt
acagataaagatcaagacccgcatactcctttaaaatttgacaataaatttttaggtttt
atgtggtctcatataggatggatgttggttggaaacggtagctataaatctattgatcgc
attacttggactaagcacgggaagaacaatttattaaaatggcagctaaaatattattgg
caaatagcagcttttatgaatattgtcgtacctttatttatcggttatttagtcggcggt
actatgcaatcagcatatgcaggatttttatttatgggactcggtagattcctgcaacaa
caagcaacattctgcgtcaattctttatgccactttatcggtagtaaaaaatattataaa
ggcactgccggagatatttggtggatgtcattattcttactcggtgaaaattggcacaat
taccatcatgcttttccttcagattatcgtaacggtgcaaaatggtatcattttgacgtt
cacaaatggataatatttttaatgagtaaagtcggtttagcttcagaactcgaacgtact
acaaaagtacggatacaggcaaaaatgcaagaaactttaagttatcttagtgaaaaacaa
aagcaaaaattgagcttaatgcaaactaaaatagatcagcttctagaaaatttatgctta
aaaattaaagagcttgaagaatcatctattacaattaaagcacaatttaaaaaatctttt
gtagaaatacaagaatcgcttaaaaatttagcggagcaaataagttctgcaacacaaata
acagaaaaatcttcagaaaaattactaaaaatagttaataaaaaaattattgatgctgaa
caatctatttataagctgtataatcaattaaataccttcaaggtatctaattaa

DBGET integrated database retrieval system