KEGG   Rickettsia canadensis McKiel: A1E_00650Help
Entry
A1E_00650         CDS       T00603                                 

Definition
hypothetical protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rcm  Rickettsia canadensis McKiel
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rcm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A1E_00650
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A1E_00650
   00650 Butanoate metabolism
    A1E_00650
  Energy metabolism
   00190 Oxidative phosphorylation
    A1E_00650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
149004..149381
Genome map
AA seq 125 aa AA seqDB search
MVYDFKVEIVKAKASGSAKSGSHHWLLQRVTAIILALCSIWLIYFTLTNKSSDLSIIMWE
LKKPFNVVALLITVIISLYHAMIGVQIVIEDYIRCNKLLNTLIIVVKLFCLVTIAAFVTA
MFYKG
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggtatatgattttaaagtggaaattgtaaaagcaaaggccagcggttctgctaaaagc
ggttctcatcattggttattacaaagggttacagcgattatattagctttatgttctata
tggttaatatattttaccttaactaataaaagtagtgatttaagtatcattatgtgggag
cttaaaaaaccttttaatgtagtagcattattaattacggtcattatttctttatatcat
gctatgatcggtgtgcagatagtaatagaagattatataagatgcaataaattacttaat
acattaattatagtagtaaaattattctgcttagttactattgcagcttttgtgacagct
atgttttataaggggtga

DBGET integrated database retrieval system