KEGG   Rickettsia canadensis McKiel: A1E_00935Help
Entry
A1E_00935         CDS       T00603                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rcm  Rickettsia canadensis McKiel
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:rcm01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:rcm00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:rcm00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
214141..215346
Genome map
AA seq 401 aa AA seqDB search
MSIKIIVPSLGESVTEATIAKWYKKEGDSVKTDDLLLEIETEKVTLEVNAPCNGTIGKIL
KTDGANVEVGEEIGEINEGAVANTAGTNNESANSQAATQPTSEKPIEKPAVANNTLAPSV
QKLVTENKLDPNNIKGTGRDGRITKGDVLETLNTPPAATTAPAMSKANEDRVQRVRMSRL
RKTIAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEFEKKHAVKLGFMSFFVKATIE
ALKLIPSVNAEIDGNDLVYKNYYDIGVAVGTELGLVVPVVRGADKMEFAEVEKAIGTLAK
KAREGKLSMADLSGGTFSISNGGVYGSLLSTPIINPPQAGILGLHKTEERPVVIDGKIEV
RPMMYIALSYDHRIIDGKEGVSFLIKIKQLIEHPEKLLLNL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagtattaaaattatagtaccatcacttggagaatccgtaacggaagcaactattgcc
aagtggtataagaaagaaggtgattcagttaaaaccgatgacttactgttagaaatcgaa
actgagaaagtaactttagaagttaatgctccttgcaacggtactataggtaaaatattg
aaaactgacggtgcaaacgtggaagttggcgaagaaataggcgaaataaatgaaggagcg
gttgcaaatactgccggtactaataatgaatctgcgaattctcaagcagccacacaacct
acttcagaaaaacctatagaaaaacctgccgttgctaataatactcttgccccttccgta
caaaaattagttaccgaaaataagcttgatccaaataatataaaaggcacaggtagagat
ggtaggattaccaaaggtgatgtgcttgaaacactaaacactccgcctgcagctactact
gctcctgcaatgagtaaagctaacgaagatagggtacagcgtgttcgtatgtcacgtttg
cgtaaaactattgcacaacgcttgaaagattcacaaaatacagcagctattttaactact
tttaatgaaatcgatatgtcaaaagtaattgcattgcgtaatcaatataaagaagagttt
gagaaaaaacacgctgtaaaacttggatttatgtcgttttttgtcaaagcaaccatagaa
gctttaaagcttattccgtcggtaaatgctgaaatagatggcaacgatttagtatataaa
aattattacgatataggggtagctgttggaacagagctagggcttgtcgtacctgttgtg
agaggcgctgataaaatggaatttgctgaagtagaaaaagctataggaactttggctaaa
aaggcacgcgaaggtaagctttctatggctgatttgtcaggagggacattctcgatttct
aacggcggcgtatatggttcattattatccacgccgattattaatccacctcaagcaggt
attttaggcttacacaaaactgaggaaagacctgtagttatagacggtaaaattgaagtg
cgcccgatgatgtatatagctttatcttacgatcatcgtataattgatggaaaagaagga
gtatcattcttgataaaaattaagcagctcattgagcatcctgagaagttattgttaaac
ttataa

DBGET integrated database retrieval system