KEGG   Rickettsia canadensis McKiel: A1E_02285Help
Entry
A1E_02285         CDS       T00603                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
rcm  Rickettsia canadensis McKiel
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rcm00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
502061..503053
Genome map
AA seq 330 aa AA seqDB search
MYPLVRLRRNRKAFWLRELIAESNLSINDLVLPLFVVDGHNERQEIKTMPGIYRLPINQI
VETAKRAAELGINAIALFPSIDQSLKSKNANEAYNLDNLICRTIRSIKNANVDIGIICDV
ALDPYTTHGHDGIVYHGEVDNDKSVRALSNQALVLAKAGVDIVAPSDMMDGRIGAIRKYL
DKEGFINVGILAYAAKYASSFYGPFRDAIRSNKRNYLDKSSYQMDVRNIKEAMLEIEHDI
SEGADMVMVKPGMPFLDVIREAANNFNAKIFAYQVSGEYAMLKFAAEAGAIDWESTIIES
LTSFKRAGATAILTYAALEVAEILKNNKIK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtatcctcttgttagacttagaagaaatagaaaagcattttggcttagagagttaata
gctgaaagtaatttatcgatcaatgatttagtgctacctttatttgttgttgatgggcat
aatgaaagacaagaaattaagactatgcctggtatatatcgtttaccgatcaatcaaata
gtagagaccgctaaaagagcagcagagcttggtattaatgctattgcattatttcctagt
attgatcaaagtctaaaaagtaaaaatgccaacgaggcttataatttagataatttgata
tgtagaactattagaagcatcaaaaacgctaatgttgatattggtataatatgcgatgta
gcactagatccttataccacacatggtcatgacggtattgtgtatcacggggaagttgat
aatgataaatcagtaagagccttaagtaatcaagcactagtgcttgcaaaagcaggggta
gatattgttgcaccttccgatatgatggatggcagaatcggagctataaggaaatacctt
gacaaagaggggtttataaatgtcggaattcttgcttatgcagctaaatatgcttcaagt
ttttacggtccgtttcgcgatgcaattaggagtaacaaaaggaattatttagataaatca
agctatcaaatggatgtacgtaatattaaggaagcaatgcttgaaattgaacacgatata
tctgaaggagctgatatggtaatggttaaaccaggtatgccgtttttagatgttattcgt
gaagcagcaaataattttaatgctaaaatttttgcatatcaggttagcggagaatatgca
atgttaaaatttgcagctgaagcaggggcaattgactgggagagtaccataattgaatca
ttaactagttttaaacgtgcaggagcaactgcgatattgacctacgcagctcttgaagta
gctgaaatattaaagaacaataaaattaagtag

DBGET integrated database retrieval system