KEGG   Rickettsia canadensis McKiel: A1E_03180Help
Entry
A1E_03180         CDS       T00603                                 

Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rcm  Rickettsia canadensis McKiel
Pathway
rcm00020  Citrate cycle (TCA cycle)
rcm00640  Propanoate metabolism
rcm01100  Metabolic pathways
rcm01110  Biosynthesis of secondary metabolites
rcm01120  Microbial metabolism in diverse environments
rcm01130  Biosynthesis of antibiotics
rcm01200  Carbon metabolism
Module
rcm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rcm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rcm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A1E_03180
   00640 Propanoate metabolism
    A1E_03180
   00660 C5-Branched dibasic acid metabolism
    A1E_03180
Enzymes [BR:rcm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     A1E_03180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABV73571
UniProt: A8EYY8
Position
661660..662820
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQAKEILRKYGIPTSTGLVVTKTEQINETIDKLNTEVYVVKAQIHAGGRGKAGGV
KVVKSKEEAKKIAHDMFGINLVTHQTGPQGQKVKRLYIESGCDILKEYYFSIVFDRSASC
ITFIASTAGGVDIEEVAKKTPEKIVKFSVDPATGLQDFHMRGIAYELGFKDNQVKQMKEI
VKSVYNAFIETDATQIEINPLIVKTDGDLLALDAKITFDENALFKHPNVTAMRDYDEEDP
LETRAANAGLSYVKMDGNIGCMVNGAGLAMATMDIIKLYGALPANFLDVGGGADCERIKE
AFKIILSDKKVQGVLVNIFGGIMRCDIISEGIIAAAKEIDIKVPLVVRLAGTNVEKGKKI
LSNSGLEIITAHDLADAANKIVEAIS
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgaatatcaagcaaaagagattttaagaaaatacggtatacctacttcc
accggactagttgtgacgaaaaccgaacagattaatgaaactatagataagttaaatacg
gaagtatatgtagttaaggcacaaatacatgctggcggtagaggtaaagcgggtggtgtt
aaggttgttaagagtaaagaagaagccaagaaaattgctcatgacatgtttggcattaat
ttagtaacacatcaaacaggacctcaaggacagaaagtaaaacgtctttatattgaatca
ggttgtgatattttaaaagaatattattttagtatcgtatttgatagatcagctagctgt
attactttcatagcttctaccgcaggaggagttgatattgaagaagtagcaaaaaaaact
ccggaaaaaattgttaaattttctgttgatcctgcaacaggtttacaagattttcatatg
cgaggcatagcttatgagctaggctttaaggataaccaagttaaacagatgaaagaaata
gtaaaatcggtatataatgcttttattgaaactgatgcaacacaaattgaaattaatcct
ttaattgtaaaaaccgacggtgatctactcgctttagacgcaaaaatcacttttgatgag
aacgccctattcaaacaccctaatgtcaccgccatgcgtgattacgatgaggaagatcct
ctagaaactagagcggcaaatgcaggacttagttatgtaaaaatggacggtaatatcggt
tgtatggttaacggtgccggtcttgccatggctactatggatattattaaactttacggt
gctttgcctgctaatttcttggatgtcggcggtggagccgattgtgagcgtataaaagaa
gcttttaaaataattttatctgataaaaaagtacaaggggtcttagttaatattttcggc
ggtattatgcgttgtgatattatatcggaaggaattattgcagctgcaaaagaaatagat
ataaaagtgccgttagtggttcgtttagccggtacaaacgttgaaaaaggcaaaaaaatt
ttatcaaattctggtttagaaataataacggcacatgatttagcagatgccgcaaataaa
atagttgaggctataagctag

DBGET integrated database retrieval system