KEGG   Rickettsia canadensis McKiel: A1E_04090Help
Entry
A1E_04090         CDS       T00603                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
rcm  Rickettsia canadensis McKiel
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rcm00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    A1E_04090
Enzymes [BR:rcm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     A1E_04090
Transfer RNA biogenesis [BR:rcm03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    A1E_04090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(835227..836006)
Genome map
AA seq 259 aa AA seqDB search
MDNNLIAALKDLIINTGKIALDIKKAGILTDIKSDGSFVTNADKEISKIIYQTLQTLTPQ
IVIVCEEQPLPILSSDTFWLIDPIDGTRSYVNGKSTYTVNIGLIEKNIPTIGLVYQPAAD
KLYYTNAKQQLKIEQNSLEIPINYESKREEFNAVIGFYNSNKATKKFLSKYSFGKINAVG
SSIKLCLIAEGAADIYPKFGQTMEWDIAAGHALIRAGGGNILDCDGKEITYGKENFANPN
FFACSKYWLEKVSKCHTVA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggacaataacttaatagctgctttaaaagatttaattattaatactggtaagattgca
ctagatataaaaaaggcaggaatattgactgatattaaatcagacggttctttcgttact
aatgccgataaggaaattagtaaaataatttatcaaactctacaaaccttaaccccacaa
atagttatagtatgtgaagagcagccgctacctatattaagtagtgatactttttggtta
atcgatcctattgacgggacacgaagctatgtaaacggtaaaagtacatatacagtaaat
atagggcttattgaaaagaatattccgaccattggcttagtataccaacctgcagcggat
aaattatattatacaaatgcgaaacaacaattaaaaatcgaacaaaattctttagaaata
cctattaactacgaatctaaaagagaggaatttaatgcagtaataggtttttataattca
aataaagctactaaaaaatttttaagcaaatattcattcggtaaaataaatgccgtaggt
agctcaatcaaattatgcttaattgctgaaggagcagctgatatatatccaaaattcggt
caaactatggagtgggatatagcggcaggtcatgctttaattagagccggtggcggtaat
attttagattgcgatggaaaagaaattacttacggtaaagaaaattttgctaatcctaat
tttttcgcctgtagcaaatattggttggaaaaagtgtcaaagtgtcatactgtagcttga

DBGET integrated database retrieval system