KEGG   Rickettsia canadensis McKiel: A1E_04920Help
Entry
A1E_04920         CDS       T00603                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
rcm  Rickettsia canadensis McKiel
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    A1E_04920 (gmk)
Enzymes [BR:rcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     A1E_04920 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(997578..998156)
Genome map
AA seq 192 aa AA seqDB search
MRTKNKGLIIILSSPSGTGKSSLAKALLKIDNNLRLSISVTTRKPRLGEVEGINYYFKTG
VEFEELVQQNKFLEYTKIYDNYYGTPKEYVEMLLNQGVDVLFDIDWQGARSIKKSSTNVV
AIFVLPPSIKVLEQRLRNRATDNEEAIKLRMQSAQNEISHANEYDYVVTNDDFDHTLKKI
HAIIVAERRKSQ
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaaaaaataaaggactgattataattttgtcttctccttcaggtacaggtaag
tcaagtttagctaaagcattattgaaaatagataataatttacgtttatctatttcagta
actacaagaaaaccacgtttaggagaagtagagggcataaactattactttaagactggt
gtagagtttgaagaattagttcagcaaaataaattccttgaatatactaaaatatacgat
aattattacggtacgcctaaagaatatgttgaaatgttattaaatcaaggtgtggatgtt
ttgtttgatattgattggcaaggagcaagaagtattaagaaaagttctactaatgttgtt
gctatatttgtattgcctcctagtattaaagtactggaacaacgcttaagaaatagagca
accgataatgaagaagcaataaagttacgtatgcagtcagcacaaaatgaaatatcacac
gctaatgagtatgattatgtagttactaacgatgattttgaccatacgcttaaaaaaata
catgcgattatagttgcagagcgaagaaaaagtcaataa

DBGET integrated database retrieval system