KEGG   Rickettsia canadensis McKiel: A1E_05580Help
Entry
A1E_05580         CDS       T00603                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
rcm  Rickettsia canadensis McKiel
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:rcm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    A1E_05580
   00240 Pyrimidine metabolism
    A1E_05580
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    A1E_05580
   03430 Mismatch repair
    A1E_05580
   03440 Homologous recombination
    A1E_05580
Enzymes [BR:rcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     A1E_05580
DNA replication proteins [BR:rcm03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     A1E_05580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1145134..1145598)
Genome map
AA seq 154 aa AA seqDB search
MQQFSIYQTSDELLLKSVLLLIEKCYYSDLKSVILTTDKEQQEMLNKNLWTYSRKQFIPH
GSKLDPQPEKQPIYITDELQNPNNASVLIIISPIDIGKILQVKDYIEVFKRIIIITHFLE
DLKELTVKVNKFTEQENKIDCFKQDMRGAWNKVK
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaatttagtatttatcaaacaagcgatgaattactgctaaaatcggtattactt
ctgatagaaaaatgttattactctgatcttaaaagtgttatacttaccactgataaagaa
cagcaggaaatgctcaataaaaatctttggacttattcacgtaagcaatttatacctcac
ggtagtaagcttgatccacagcctgaaaaacagccgatttatattaccgatgagttacaa
aatcctaataatgctagtgtgcttatcattatttcacccatagatataggaaaaatttta
caagttaaagactatatagaagtttttaaaagaataattattataactcattttctggaa
gatttaaaagaattaacagttaaagtaaataaatttactgagcaggaaaataaaatcgat
tgttttaaacaagatatgcggggtgcatggaataaagtaaaataa

DBGET integrated database retrieval system