KEGG   Rickettsia canadensis McKiel: A1E_05585Help
Entry
A1E_05585         CDS       T00603                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rcm  Rickettsia canadensis McKiel
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rcm01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:rcm00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1145881..1147035)
Genome map
AA seq 384 aa AA seqDB search
MYINYLKDLIGFKSVTPESNLAIEYIDDLLKKHGFKTEIKIFGDSKSEQVTNLYAVYGNG
KPNICFVGHVDVVPAGDYHLWHNSAPFKANEQDGKIYGRGVVDMKGAIACFLTAALDLIK
NNPDFKGSISFLLTSDEEGKAKHGTKEMLQYIYDQEYKIDFAVVGEPTCETEIGDTIKIG
RRGSVNFKLNIEGLVGHVAYPHKANNPLSCLIKILNELINIKFDEGTEFFQSSNLEVTNI
DVGNNTSNVIPASVEAYFNIRFNNLHNAETLGQLIEQIVKRYCKEYKVDYKLEYISAAES
FIQNPNDKIKDFADIVESTLKIKPKFSTSGGTSDARFVKNYCSLVEFGLLSEMAHKINEY
TKISDLQKLYDVYYNFLMEMLTNK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtacattaactacttaaaagatttgatcggttttaagtctgtaactcctgagagtaac
ctggctattgagtatattgatgatttgcttaaaaaacacggctttaagaccgaaataaaa
atattcggtgattctaaaagtgagcaagttactaatctttatgccgtgtatggtaacggc
aaacctaatatttgctttgttgggcatgtagatgtagtgcctgctggtgattatcacctg
tggcataattcggctccgtttaaggctaatgaacaagacggaaagatatacggcaggggt
gtagtggatatgaaaggagctatagcgtgctttctaactgcagctttagatcttataaaa
aataatcctgattttaaaggttccattagtttcttacttactagtgatgaagagggaaaa
gcaaaacacggtactaaagaaatgctgcaatatatttatgatcaagagtataagattgat
tttgctgttgtcggtgagcctacttgcgaaacagaaataggtgatacaattaagattggc
agaagaggaagcgttaactttaaattaaatatagaaggcttagtagggcatgtagcttat
cctcataaagctaataatcctttgtcttgcttaataaaaatattgaacgagttaataaat
ataaaatttgatgagggaacagagttttttcaaagttcaaatcttgaagtgacaaatatt
gatgttggcaataatacttcaaatgtaattcctgcaagtgtggaagcatatttcaatata
cgttttaataatttacataatgcagaaactttagggcaattaatagagcaaattgttaaa
cgatattgcaaagaatataaagtagactataagctagaatatattagtgctgctgaaagt
tttattcagaatcctaacgataaaataaaagattttgctgatatagtagagagcacatta
aaaataaagcccaaattctctacaagcggtggtacctcggatgcaagattcgttaaaaat
tattgctccttggtagagtttggtttattatctgaaatggcacataaaataaacgaatat
accaaaattagtgatttacaaaaattatatgatgtgtattataattttttgatggaaatg
ctgactaataaatag

DBGET integrated database retrieval system