KEGG   Rickettsia canadensis McKiel: A1E_05640Help
Entry
A1E_05640         CDS       T00603                                 

Definition
oxidoreductase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rcm  Rickettsia canadensis McKiel
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rcm00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:rcm00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1152633..1153097
Genome map
AA seq 154 aa AA seqDB search
MKDKVTVITGSTSGIGLKIAKHFAKLESKIVINGFTKEDEVAKISAELKELGASSVFYQG
INLEKPDEIRSMFEKIIKEFGKIDILVNNAGIQHVAPIDEFPEDKWEQILRIDLIASFYT
TKYVIPIMKKTALDESSTSLPLMHMLHHHLSQHM
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacaaagtaacagttattaccggttctactagcggtatcggtcttaagatagca
aaacattttgcaaaacttgagtctaaaatagttattaacggttttacaaaagaagatgaa
gtagccaaaatttcagcagaattaaaagaacttggtgcaagtagtgtattttatcaagga
ataaatttggaaaagcctgatgaaattcgttctatgttcgagaaaataataaaagaattc
ggcaaaatagatatattagtaaataacgcaggtattcaacatgttgcccctattgatgaa
tttcctgaagataaatgggagcaaatactacgtatagatttaatagcttctttttatact
acaaaatacgtaataccgattatgaaaaaaacggctttggacgaatcgtcaacatcgctt
ccgctcatgcatatgttgcatcaccatttaagtcagcatatgtag

DBGET integrated database retrieval system