KEGG   Rickettsia conorii: RC0037Help
Entry
RC0037            CDS       T00061                                 

Definition
folate synthesis bifunctional protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
rco  Rickettsia conorii
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RC0037
Enzymes [BR:rco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     RC0037
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     RC0037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(35416..35838)
Genome map
AA seq 140 aa AA seqDB search
MSLTKIEKQLGRVSSYDKWSPRVIDLDILLWNNCHIDLPDLKIPHPELLNRPFLIHLIAG
LSLECRYSCPINNFYNNKTFAAIAHLIEHQGVIRSLVLNPQFVGILNITPDSFSDGGLSF
HEEDAVRNFVRLINEGATIN
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
ttgagcttaacaaagattgaaaaacaactaggtcgagtaagctcttacgataaatggtct
ccaagagttattgacttagatatcctactttggaataattgccatatagatttacctgat
ttaaagataccgcatcctgaattattaaacagaccgtttcttattcatctaattgcaggt
ttaagcttggaatgtcgttattcatgtccgatcaataatttttacaacaataaaaccttt
gcagcaatagcacatttaattgaacatcaaggagttatacgctctcttgttttaaatcct
caatttgtcggtattttaaacattactcctgattctttttctgatggaggattgagtttt
catgaagaagatgccgttagaaattttgtacgcttgataaatgaaggggctacaataaat
tga

DBGET integrated database retrieval system