KEGG   Rickettsia conorii: RC0169Help
Entry
RC0169            CDS       T00061                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rco  Rickettsia conorii
Pathway
rco00020  Citrate cycle (TCA cycle)
rco00190  Oxidative phosphorylation
rco00650  Butanoate metabolism
rco01100  Metabolic pathways
rco01110  Biosynthesis of secondary metabolites
rco01120  Microbial metabolism in diverse environments
rco01130  Biosynthesis of antibiotics
rco01200  Carbon metabolism
Module
rco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rco_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rco_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rco00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RC0169 (sdhD)
   00650 Butanoate metabolism
    RC0169 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    RC0169 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS tRNA_anti_2 PAP2
Motif
Other DBs
NCBI-ProteinID: AAL02707
UniProt: Q92J98
Position
168113..168493
Genome map
AA seq 126 aa AA seqDB search
MVYDFKAEIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFTLTNKNNDINIIMLW
ELKKPFNVVALLITVVISLYHAMLGMRVVIEDYISYHKLRNTLIIIVQLFCIVTIVAFVV
ALFYKG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggtatatgattttaaagcagaaattgtaaaagcaaaaaatagcggttctgctaaaagc
ggttctcatcattggttattgcaaagagtaacggggattatattagctttatgttctgtg
tggctaatatattttacgttaaccaacaaaaataatgatataaatattattatgttgtgg
gaacttaaaaagccttttaatgtagtagctttgttaattacggtggttatttcgttgtat
catgcgatgcttggtatgcgtgtagtaattgaagattatataagttatcacaaattacgt
aatacattgattataatagtgcaattattttgcattgttactattgtagcttttgtagta
gcgctgttttataaaggataa

DBGET integrated database retrieval system