KEGG   Rickettsia conorii: RC0226Help
Entry
RC0226            CDS       T00061                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rco  Rickettsia conorii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RC0226 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RC0226 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    RC0226 (sucB)
Enzymes [BR:rco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RC0226 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(232626..233813)
Genome map
AA seq 395 aa AA seqDB search
MRVKIIVPSLGESITEATIAKWYKKQGDSVKTDELLLEIETEKVTLEVNAPCNGTIGKIS
KTEGANVAVGEEIGEINEGASANTAGTNNESAKAQAVTQPTSEKPAVANNTLAPSVQKLV
TENKLDPNNIKGTGRDGRITKGDVLATINTTTTSAPAISKSNEERVQRVRMSRLRKTIAQ
RLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEFEKKHAVKLGFMSFFVKATIEALKLIP
SVNAEIDGDDLVYKNYYDIGVAVGTEQGLVVPVVRDADKMGFAEVEKTIGILAKQAREGK
LSMADLSGGTFSISNGGVYGSLLSTPIINPPQSGILGLHKTEERAVVIDGKIEIRPMMYI
ALSYDHRIIDGKEGVSFLVKIKQLIENPEKLLLNL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagagttaaaattatagtaccgtcgcttggggagtccataacagaagcaactattgcc
aaatggtataagaaacaaggcgattcggttaaaaccgatgaattactgttagaaatcgaa
accgaaaaagtgactttagaagttaatgctccttgcaatggtactataggtaaaatatcg
aaaactgaaggtgcaaatgtagcagttggcgaagaaataggcgaaataaatgaaggagca
tctgcaaatactgccggtactaataatgaatctgctaaagctcaagcagtaacacaacct
acttcagaaaaacctgccgtggctaataatactcttgctccttctgtacaaaaattagtg
accgaaaataagcttgaccccaataatataaaaggaacaggtagagacggtagaattacc
aaaggtgacgtgcttgcaacaataaacactacgactacttctgctcctgcaataagtaaa
tctaatgaagaaagagtgcagcgtgttcgtatgtcacgcttgcgtaaaactattgcacag
cgtttaaaagattcacaaaatacagcagctattttgactacttttaatgaaatcgatatg
tcaaaagtaattgctttgcgtaatcaatataaagaagagtttgagaaaaagcacgctgtg
aaacttgggtttatgtctttctttgttaaagcaacaattgaagctttaaagcttattccg
tcggtaaatgctgaaatagatggcgatgatttagtatataaaaattactatgatataggt
gtagctgtcggaacagagcaagggcttgttgtaccggttgttagggatgccgataaaatg
ggttttgccgaagtggagaaaactataggaattttggctaaacaagctcgtgagggtaag
ctttctatggctgatttgtcaggtgggacattctcgatttctaacggaggcgtatatggc
tcattattatctacaccgattattaatcctcctcaatcaggtattctaggcttacataaa
accgaggaaagagctgtagttatagacggtaaaattgaaatacgtccgatgatgtatata
gctttatcttacgatcatcgtataattgacgggaaagaaggagtatcgttcttggtaaaa
attaagcagcttattgagaatcctgaaaagttattgttaaatttgtaa

DBGET integrated database retrieval system