KEGG   Rickettsia conorii: RC0400Help
Entry
RC0400            CDS       T00061                                 

Gene name
cysQ
Definition
cysQ protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
rco  Rickettsia conorii
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rco00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RC0400 (cysQ)
Enzymes [BR:rco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     RC0400 (cysQ)
Transfer RNA biogenesis [BR:rco03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    RC0400 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
399240..400016
Genome map
AA seq 258 aa AA seqDB search
MNDNLINALKDLIINTGKIALDIKKAGMLTDIKSDGSVVTNADKEISKIIYQTLQTLTSQ
IAIVCEEQPLPIFSSDTFWLIDPIDGTWSYVNGKSTYTVNIGLIENGFPTIGLIYHPETA
KLYYTDVNGRLKIEQNSKEIFVNHEPKHEELNAVIGFYNSNKATKEFLSKYSFGQINAIG
SSMKLCLIAEGAADIYPKFGQTMEWDIAAGHALIKAGGGNILDTHGQEITYGKESFANPN
FFACSKYWLEREARLHRY
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacaatttaattaatgctttaaaagatttaattattaataccggcaagattgca
ctagatataaaaaaggcaggaatgttgactgatattaaatcagatgggtcagtagtcact
aatgccgataaagaaattagtaaaataatttatcaaactctacaaaccttaacctctcaa
atagctatagtatgtgaagagcagccgctacctatattcagcagtgatactttttggtta
atcgatcctattgatgggacatggagctatgtaaacggtaaaagtacatatacggtcaat
atagggcttattgaaaacggttttccaaccatcggcttgatatatcaccctgaaacagca
aagctatattatactgatgtaaacggtcggttaaaaatcgaacagaattctaaagaaata
tttgttaatcatgaaccgaaacatgaagagcttaatgcggtaataggtttttataattca
aataaagctactaaagaatttttaagtaagtattcattcggtcaaataaatgcaataggc
agttcaatgaaactatgcttaattgctgaaggagcagctgatatatatccaaaattcggt
caaactatggaatgggacatagcggcaggtcatgctttaattaaagccggcggtggtaat
attttagatacgcatggacaagaaattacttacggtaaagaaagttttgctaatcctaat
tttttcgcctgtagtaaatattggttggaaagggaggcaaggttgcatagatactag

DBGET integrated database retrieval system