KEGG   Rickettsia conorii: RC0531Help
Entry
RC0531            CDS       T00061                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rco  Rickettsia conorii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rco00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RC0531 (ruvA)
Enzymes [BR:rco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     RC0531 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
521234..521845
Genome map
AA seq 203 aa AA seqDB search
MIGQLSGKVDSQGDDYVIIDVNGVGYLVYASGKTLGKLAEGEFYKLFIETHVREEHIHLY
GFLTLEEKIFFNLLQSVNGIGTRMALFILSSLTPSDIQIAVNNEDKNIFKAISGVGAKLA
ERIVLELKGKVAKISSGSAIIKESLNIKNITPVASNEVIKALVNLGFSRFEAQNAVQGII
TQNPEISIDELIKTALKNRNSNF
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcaattaagtggtaaagttgattcccaaggcgatgattacgttataattgac
gtaaacggggtagggtacttagtctatgcttcaggtaaaactttaggtaaacttgctgaa
ggggagttttataaactatttatcgaaacccatgttagagaggaacatattcatctttac
ggttttttgactctagaagagaagattttttttaatttactacaatcagtaaacggtata
ggtacaagaatggctttatttatcttatcaagccttacgccttcagatattcaaattgct
gtaaataatgaagataaaaatatatttaaagcaatatccggagtaggggctaaacttgct
gaacgtatagtgctagagctgaaaggtaaagtagcgaaaatatcaagcggttcagctatt
attaaagagagcttaaatattaagaatatcacacccgttgcaagtaatgaagtaataaaa
gctctagtaaatctaggattttctagatttgaagctcaaaacgctgttcaaggcatcatt
acccaaaatcccgaaatctctattgatgaattaatcaaaacagccctgaaaaatcgcaat
tctaatttttag

DBGET integrated database retrieval system