KEGG   Rickettsia conorii: RC0609Help
Entry
RC0609            CDS       T00061                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rco  Rickettsia conorii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rco00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RC0609 (recR)
DNA repair and recombination proteins [BR:rco03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      RC0609 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
594180..594785
Genome map
AA seq 201 aa AA seqDB search
MNETNDNDIDQLIYLFSKLPGLGIRSARRIALYLLQDKDIRLKSLINNLVEIDKKIVKCE
ICGNMDTENMCRICSSEYRDKSIIAIVETVAELWAMERSGNFKGLYHVLGHNLSATSRQN
PSILRLPELLTRCFAENIKEVIIATNSTLEGQTTAYFITEYLKEHPAKISRLASGIPIGG
ELDYLDEGTVSAAINLRQPFE
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaacaaatgataatgatatagatcagctaatttatcttttttcaaaattaccc
ggtcttggtattagatcggcaaggcgtatagcgctttacctattgcaagataaagacata
aggttaaaaagcctgattaataatcttgtagagatagataagaaaatagtaaaatgcgag
atttgcggtaatatggatacggaaaatatgtgccgtatttgttcttctgaatatagagat
aaatcaattattgctattgtcgaaactgtggctgaattatgggcaatggagcgtagcggt
aattttaaaggtttatatcatgtactcggtcataatttatcggcaactagtagacaaaac
cctagcatacttcggttacctgaactacttacaagatgttttgcagaaaatattaaagaa
gttattattgctactaattctactttagaaggtcagactactgcttattttattacagaa
tatttaaaagagcatcctgctaaaatttctcgccttgctagcggtatacctatcggaggt
gaacttgattatttagacgagggtaccgtatctgccgctattaacctacgccaacctttt
gagtaa

DBGET integrated database retrieval system