KEGG   Rickettsia conorii: RC0910Help
Entry
RC0910            CDS       T00061                                 

Gene name
mraY1
Definition
(GenBank) phospho-N-acetylmuramoyl-pentapeptide-transferase
  KO
K01000  
phospho-N-acetylmuramoyl-pentapeptide-transferase [EC:2.7.8.13]
Organism
rco  Rickettsia conorii
Pathway
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rco00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RC0910 (mraY1)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    RC0910 (mraY1)
Enzymes [BR:rco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.13  phospho-N-acetylmuramoyl-pentapeptide-transferase
     RC0910 (mraY1)
Peptidoglycan biosynthesis and degradation proteins [BR:rco01011]
 Precursor biosynthesis
  Glycosyltransferase
   RC0910 (mraY1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(854314..855399)
Genome map
AA seq 361 aa AA seqDB search
MLYNLLLPHIHNSHIANLFHYITFRSALAIIITLSLSFITGPILIEFLRSLQKNGQPIRS
DGPESHQTKVGTPTMGGIMIILSSCLSTLLLADLTNKYIWITLFGFISFGIIGFMDDYAK
VTKDNHYGVRGKSKLLLQGIISFIICVLLEYLDKSPSHLLNVPFFKNLSLDLGYCYIVFA
IFVIVGSSNAVNLTDGLDGLATVPIAFTAGSFALISYLVGNLIYSNYLQLTYIPNTGELT
VLCAGLVGSCLGFLWFNAQPAEVFMGDTGSLSLGGVLGIISVITKHEIVLAIVGGLFVIE
TASVILQVYYFKATKGKRIFKMAPLHHHFEKHGWAESKVVIRFWIISVIFALIGLSSLKL
R
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgttatacaatcttttactccctcatatccataattcacatatagctaatttatttcac
tatattacttttcgtagcgctcttgctattattataactctaagccttagctttatcacg
ggtccgatattaatagaatttctgcgatctcttcaaaaaaacggtcagcctatacgctca
gacggacctgaatcgcatcaaacaaaagtaggtactccgacaatggggggcattatgatt
attttgtctagttgtctttctactttattacttgctgatttaacgaataaatatatttgg
attacgttatttggttttattagtttcggtattataggatttatggatgattatgctaag
gtaactaaagataatcattacggagtaagaggaaaaagtaagcttttacttcaaggaatt
attagcttcattatatgtgttttactagaatatctagataaaagtccaagtcatttactt
aacgtaccgttttttaaaaatttaagtttggatcttggttattgttatatagtttttgct
atatttgttatagtcggctcttctaatgccgtgaatctaacggatgggcttgatggtctt
gctaccgttcctattgcctttactgccggttcttttgctttaataagttatttagtagga
aatctaatttactcgaactacttacagctaacctatataccgaataccggagagttaacg
gtgttatgtgcgggattagtcggtagctgccttggatttttatggtttaatgcacaaccg
gcagaagtttttatgggcgataccggtagtctaagtcttggcggtgtgcttggtattatt
agcgttattactaagcatgaaatagttttagctatagtcggcggcttgtttgttattgaa
acggcatccgtaattttacaggtatattacttcaaagctactaaaggaaaaagaatattt
aaaatggcaccgctccatcatcattttgaaaaacacggctgggcagaatcaaaagtcgta
ataagattttggattatttcagttatatttgctcttataggcttatcatccttaaaatta
cgttaa

DBGET integrated database retrieval system